Donate
   
Select your preferred input and type any Sanskrit or English word. Enclose the word in “” for an EXACT match e.g. “yoga”.
Root Search
vad has 6 results
        Root Word (Pāṇini Dhātupāṭha:)Full Root MarkerSenseClassSutra
√vaḍvaḍiivibhājane1174
√vaḍvaḍiivibhājane1044
√vadvadaavyaktāyāṃ vāci1735
√vadvadaasandeśavacane10232
√vadvadiiabhivādanastutyoḥ111
√vāḍvāḍṛṛāplāvye1188
 
 
vad has 3 results
Root WordIAST MeaningMonier Williams PageClass
√वद्vadspeaking distinctly / vyaktāvāc1029/2, 936/1Cl.1
√वद्vadcausing to speak, causing to sound / sandeśa-vacana1143/2Cl.10
√वाड्vāḍdiving, emerging, bathing / āplāvya144/3 [See बाड् (272/2)]Cl.1
Amarakosha Search
47 results
WordReferenceGenderNumberSynonymsDefinition
antardhā1.3.12FeminineSingularapidhānam, tirodhānam, pidhānam, vyavadhā, ācchādanam, antardhiḥ, apavāraṇamcovering or disappearing
asuraḥ1.1.12MasculineSingularditisutaḥ, indrāriḥ, daityaḥ, suradviṣ, śukraśiṣyaḥ, danujaḥ, pūrvadevaḥ, dānavaḥ, daiteyaḥgiant
bahupradaḥ3.1.4MasculineSingularvadānyaḥ, sthūlalakṣyaḥ, dānaśauṇḍaḥ
cūrṇitaḥ3.1.93MasculineSingularavadadhvastaḥ
daraḥ3.3.192MasculineSingularvinā, tādarthyam, paridhānam, avasaraḥ, ātmīyaḥ, bhedaḥ, avadhiḥ, antarātmā, bahiḥ, chidram, antardhiḥ, avakāśaḥ, madhyaḥ
dhurāvahaḥ2.9.66MasculineSingularsarvadhurīṇaḥ
drutāvadīrṇaḥ3.1.88MasculineSingularavadīrṇaḥ
garhyavādī3.1.34MasculineSingularkadvadaḥ
gauḥ2.9.67-72FeminineSingularupasaryā, rohiṇī, bahusūtiḥ, kapilā, navasūtikā, ekahāyanī, droṇakṣīrā, bandhyā, saurabheyī, garbhopaghātinī, arjunī, acaṇḍī, dhavalā, vaṣkayiṇī, dvivarṣā, pīnoghnī, tryabdā, samāṃsamīnā, sandhinī, vaśā, praṣṭhauhī, naicikī, pareṣṭukā, pāṭalā, suvratā, caturabdā, droṇadugdhā, avatokā, usrā, kālyā, aghnyā, sukarā, kṛṣṇā, dhenuḥ, ekābdā, pīvarastanī, trihāyaṇī, māheyī, vehad, śṛṅgiṇī, bālagarbhiṇī, śavalī, cirasūtā, dvihāyanī, sukhasaṃdohyā, caturhāyaṇī, dhenuṣyā, sravadgarbhā, mātā(49)cow
khanitram2.9.13NeuterSingularavadāraṇam
ku3.3.248MasculineSingularavadhāraṇam, bhedaḥ
marunmālāFeminineSingularsamudrāntā, devī, koṭivarṣā, laghuḥ, spṛkkā, vadhūḥ, latā, piśunā, laṅkopikā
mukham2.6.90NeuterSingularvadanam, tuṇḍam, ānanam, lapanam, vaktram, āsyam
nikṛṣṭaḥ3.1.53MasculineSingularrephaḥ, garhyaḥ, kutsitaḥ, avamaḥ, arvā, kheṭaḥ, kupūyaḥ, yāpyaḥ, pratikṛṣṭaḥ, aṇakaḥ, avadyaḥ, adhamaḥ
palaṅkaṣāFeminineSingulargokṣurakaḥ, vanaśṛṅgāṭaḥ, ikṣugandhā, śvadaṃṣṭrā, svādukaṇṭakaḥ, gokaṇṭakaḥ
prāduḥ3.3.264MasculineSingularhetuḥ, avadhāraṇam
pramādaḥ1.7.30MasculineSingularanavadhānatāinadvertency or mistake
purastāt3.3.254MasculineSingularanunayaḥ, āmantraṇam, praśnaḥ, avadhāraṇam, anujñā
raktam3.3.86MasculineSingularanavadhiḥ
śaklaḥ3.1.33MasculineSingularpriyaṃvadaḥ
śakrapādapaḥ2.2.53MasculineSingulardevadāru, bhadradāru, drukilimam, pītadāru, dāru, pūtikāṣṭham, pāribhadrakaḥ
saṃkalpaḥMasculineSingularpraṇidhānam, avadhānam, samādhānamdetermination
saṃvarttikāFeminineSingularnavadalama new leaf of lotus
snuṣā2.6.9FeminineSingularjanī, vadhūḥ
strī2.6.2FeminineSingularsīmantinī, abalā, mahilā, pratīpadarśinī, nārī, yoṣit, vanitā, vadhūḥ, yoṣā, vāmā
śuklaḥ1.5.12MasculineSingulardhavalaḥ, sitaḥ, śyetaḥ, śuciḥ, valakṣaḥ, avadātaḥ, viśadaḥ, śubhraḥ, arjunaḥ, gauraḥ, pāṇḍaraḥ, śvetaḥwhite
svāhā2.4.8MasculineSingularśrauṣaṭ, vauṣaṭ, vaṣaṭ, svadhā
uśīramMasculineSingularlaghulayam, amṛṇālam, abhayam, iṣṭakāpatham, lāmajjakam, sevyam, avadāham, jalāśayam, naladam
vadānyaḥ3.3.168MasculineSingularpitrādyaḥ, gīrpatiḥ
vadhū2.6.9FeminineSingular
vadhūḥ3.3.109FeminineSingulartamaḥ
vaktā3.1.33MasculineSingularvadaḥ, vadāvadaḥ
vārtā3.3.82FeminineSingularśāstram, avadhṛtiḥ
vārtāvahaḥ2.10.15MasculineSingular‍vaivadhikaḥ
vyādhaḥ2.10.19MasculineSingularmṛgavadhājīvaḥ, mṛgayuḥ, lubdhakaḥ
kiṃvadantī1.6.7FeminineSingularjanaśrutiḥrumour
āragvadhaḥ2.4.23MasculineSingularsaṃpākaḥ, caturaṅgulaḥ, ārevataḥ, vyādhighātaḥ, kṛtamālaḥ, rājavṛkṣaḥ, suvarṇakaḥ
aurdhvadaihikam2.7.32NeuterSingular
pāraśvadhikaḥ2.8.71MasculineSingular
viṣvadyūṅ3.1.33MasculineSingular
vāvadūkaḥ3.1.33MasculineSingularvāgmī, ativaktā, vācoyuktipaṭuḥ
drutāvadīrṇaḥ3.1.88MasculineSingularavadīrṇaḥ
avadānam3.2.3NeuterSingularkarmavṛttam
avadātaḥ3.3.87MasculineSingularkhyātaḥ, hṛṣṭaḥ
vivadhaḥ3.3.103MasculineSingulardoṣotpādaḥ, prakṛtyādivinaśvaraḥ(vyākaraṇe), mukhyānuyāyīśiśuḥ, prakṛtasyānuvartanam
vīvadhaḥ3.3.103MasculineSingularviṣṇuḥ, candramā
avadhiḥ3.3.106MasculineSingularnadaviśeṣaḥ, abdhiḥ, sarit
Monier-Williams Search
1891 results for vad
Devanagari
BrahmiEXPERIMENTAL
vad cl.1 P. A1. () v/adati-, te- (Epic mc. also vādati-; Potential udeyam- ; perfect tense uvāda- plural ūdim/a- ; ūde-etc. ; veditha-, dailuḥ-, duḥ- ; Aorist avādīt-, diṣuḥ- etc.; subjunctive vādiṣaḥ- ; avādiran- ; vadiṣma-, ṣihāḥ- ; preceding udyāt- ; future vadiṣy/ati-, te- etc.; infinitive mood v/aditos- ; vaditum- etc.; ind.p. uditvā- ; -udya- ), to speak, say, utter, tell, report, speak to, talk with, address (P.or A1.;with accusative of the thing said, and accusative [with or without abhi-]or genitive case,or locative case of the person addressed;also followed by yad-,"that", or by yadi-,"whether") etc. ; (P.) to praise, recommend ; to adjudge, adjudicate ; to indicate, designate ; to proclaim, announce, foretell, bespeak etc. ; to allege, affirm ; to declare (any one or anything) to be, call (two accusative or accusative and Nominal verb with iti-) etc. ; (with or scilicet vācam-) to raise the voice, sing, utter a cry (said of birds and 9.) etc. ; (A1.) to say, tell, speak to (accusative) etc. ; to mention, state, communicate, name ; to confer or dispute about ; to contend, quarrel ; to lay claim to (locative case) ; to be an authority, be eminent in (locative case) ; to triumph, exult : Passive voice udy/ate- (Aorist avādi-), to be said or spoken etc. : Causal vād/ayati- m.c. also te- (see ; Aorist avīvadat-; Passive voice vādyate-, Epic also ti-), to cause to speak or say ; to cause to sound, strike, play (with instrumental case,rarely locative case of the instrument) etc. ; to play music ; (with bahu-) to make much ado about one's self. ; to cause a musical instrument (accusative) to be played by (instrumental case) Va1rtt. 2 ; to speak, recite, rehearse : Desiderative vivadiṣati-, te-, to desire to speak, : Intensive v/āvadīti- ( ), vāvady/ate-, (), vāvatti- (grammar), to speak or sound aloud. [ confer, compare Lit.vadi4nti.]
vadamfn. speaking, a speaker (only in fine compositi or 'at the end of a compound';See ku-v-, priyaṃ.v-) View this entry on the original dictionary page scan.
vadamfn. speaking well or sensibly View this entry on the original dictionary page scan.
vadam. Name of the first veda- (with the Magians) View this entry on the original dictionary page scan.
vadabhikāram. Name of a man gaRa kurv-ādi- (see bābhī-kara-). View this entry on the original dictionary page scan.
vadakaSee dur-v-. View this entry on the original dictionary page scan.
vadālam. a kind of Silurus or sheat-fish View this entry on the original dictionary page scan.
vadālam. an eddy or whirlpool View this entry on the original dictionary page scan.
vadālakam. equals vadāla-, a kind of sheat-fish
vadāmam. (fr. Persian $) an almond (see bādāma-). View this entry on the original dictionary page scan.
vadamānamfn. speaking, saying etc. View this entry on the original dictionary page scan.
vadamānamfn. glorifying, boasting View this entry on the original dictionary page scan.
vadanan. (in fine compositi or 'at the end of a compound' f(ā-).) the act of speaking, talking, sounding View this entry on the original dictionary page scan.
vadanan. the mouth, face, countenance etc. (naṃ- kṛ-,to make a face or grimace, nī-bhū-,to become a face) View this entry on the original dictionary page scan.
vadanan. the front, point View this entry on the original dictionary page scan.
vadanan. (in algebra) the first term, initial quantity or term of a progression View this entry on the original dictionary page scan.
vadanan. (in geometry) the side opposite to the base, the summit or apex of a triangle View this entry on the original dictionary page scan.
vadanacchada wrong reading for radana-cch- View this entry on the original dictionary page scan.
vadanadanturam. plural Name of a people View this entry on the original dictionary page scan.
vadanakaṃjan. a lotus-face View this entry on the original dictionary page scan.
vadanamadirāf. the wine or nectar of the mouth View this entry on the original dictionary page scan.
vadanamālinyan. a troubled face, shame-faced appearance View this entry on the original dictionary page scan.
vadanamarutam. equals -pavana- View this entry on the original dictionary page scan.
vadanāmayam. mouth-disease, face-sickness View this entry on the original dictionary page scan.
vadanapaṅkajan. equals -kaṃja- View this entry on the original dictionary page scan.
vadanapavanam. "mouth-wind", breath View this entry on the original dictionary page scan.
vadanarogam. mouth-disease View this entry on the original dictionary page scan.
vadanasarojan. equals -kaṃja- View this entry on the original dictionary page scan.
vadanāsavam. "mouth-liquor", saliva, spittle View this entry on the original dictionary page scan.
vadanaśyāmikāf. "blackness of the face", a kind of disease View this entry on the original dictionary page scan.
vadanendum. "face-moon", the face View this entry on the original dictionary page scan.
vadanodaran. "mouth-hole", the jaws View this entry on the original dictionary page scan.
vadantaSee kiṃ-v- View this entry on the original dictionary page scan.
vadanti See kiṃ-v- View this entry on the original dictionary page scan.
vadantīSee kiṃ-v- View this entry on the original dictionary page scan.
vadantikam. plural Name of a people View this entry on the original dictionary page scan.
vadanyamfn. equals vadānya- View this entry on the original dictionary page scan.
vadānyamf(ā-)n. bountiful, liberal, munificent, a munificent giver etc. View this entry on the original dictionary page scan.
vadānyamf(ā-)n. eloquent, speaking kindly or agreeably, affable View this entry on the original dictionary page scan.
vadānyam. Name of a ṛṣi- View this entry on the original dictionary page scan.
vadānyasreṣṭham. "best of givers", Name of dadhyac- (q.v) View this entry on the original dictionary page scan.
vadara rika- etc. See badara-. View this entry on the original dictionary page scan.
vadāvadamfn. (prob. an old Intensive; see carācara-, calācala-etc.) speaking much or well, a speaker Va1rtt. 6 (see a-vadāvada-). View this entry on the original dictionary page scan.
vadāvadinmfn. idem or 'mfn. (prob. an old Intensive; see carācara-, calācala-etc.) speaking much or well, a speaker Va1rtt. 6 (see a-vadāvada-).' View this entry on the original dictionary page scan.
vaddaka varia lectio for vaṭṭaka- (q.v) View this entry on the original dictionary page scan.
vaddhrī varia lectio for vadhrī- (q.v under vadhra-). View this entry on the original dictionary page scan.
vaddivāsam. or n. (?) Name of a place View this entry on the original dictionary page scan.
vadh (also written badh-; confer, compare bādh-;properly only used in the Aorist and preceding tenses avadhīt-and dhiṣṭa-; vadhyāt-and vadhiṣīṣṭa- ;the other tenses being supplied by han-; confer, compare ;but in Vedic or Veda and Epic poetry also present tense vadhati-; Potential vadhet-; future vadhiṣyati-, te-;other Vedic or Veda forms are Aorist avadhīm-, v/ahīm- subjunctive vadhiṣaḥ-; badhīḥ- ; preceding badhyāsam-, suḥ- ), to strike, slay, kill, murder, defeat, destroy etc. etc.: Passive voice vadhyate-, ti- (Aorist avadhi-), to be slain or killed : Causal vadhayati-, to kill, slay [a. Greek .] View this entry on the original dictionary page scan.
vadham. one who kills, a slayer, vanquisher, destroyer View this entry on the original dictionary page scan.
vadham. a deadly weapon (especially indra-'s thunderbolt) View this entry on the original dictionary page scan.
vadham. the act of striking or killing, slaughter, murder, death, destruction etc. View this entry on the original dictionary page scan.
vadham. (in law) capital or (more commonly) corporal punishment etc. equals vadha-bhūmi-, place of execution View this entry on the original dictionary page scan.
vadham. stroke, hurt, injury View this entry on the original dictionary page scan.
vadham. paralysis View this entry on the original dictionary page scan.
vadham. annihilation, disappearance (of inanimate things) etc. View this entry on the original dictionary page scan.
vadham. frustration, prevention View this entry on the original dictionary page scan.
vadham. a defect, imperfection (28 are enumerated) View this entry on the original dictionary page scan.
vadham. multiplication View this entry on the original dictionary page scan.
vadham. a product View this entry on the original dictionary page scan.
vadham. Name of a rākṣasa- View this entry on the original dictionary page scan.
vadhāf. a kind of pot-herb, Convolvulus Repens View this entry on the original dictionary page scan.
vadhāind. gaRa cādi-. View this entry on the original dictionary page scan.
vadhabandham. du death and bonds View this entry on the original dictionary page scan.
vadhabhūmif. a place of execution (see vadhya-bh-). View this entry on the original dictionary page scan.
vadhadaṇḍam. capital or corporal punishment View this entry on the original dictionary page scan.
vadhaiṣinmf(iṇī-)n. desirous of killing View this entry on the original dictionary page scan.
vadhajīvinm. "living by killing (animals)", a butcher, hunter etc. View this entry on the original dictionary page scan.
vadhakamfn. killing, destructive View this entry on the original dictionary page scan.
vadhakamfn. intending to strike or kill View this entry on the original dictionary page scan.
vadhakam. a murderer, assassin View this entry on the original dictionary page scan.
vadhakam. an executioner, hangman View this entry on the original dictionary page scan.
vadhakam. a particular sort of reed or rush View this entry on the original dictionary page scan.
vadhakāmamfn. desirous of killing View this entry on the original dictionary page scan.
vadhakāmyāf. desire to kill, intention to hurt View this entry on the original dictionary page scan.
vadhakānkṣinmf(iṇī-)n. wishing for death View this entry on the original dictionary page scan.
vadhakarmādhikārinm. "one who superintends the act of putting to death", an executioner, hangman View this entry on the original dictionary page scan.
vadhakṣamamfn. deserving death View this entry on the original dictionary page scan.
vadhanāf. a deadly weapon View this entry on the original dictionary page scan.
vadhāṅgakan. a prison View this entry on the original dictionary page scan.
vadhanigraham. capital punishment View this entry on the original dictionary page scan.
vadhanirṇekam. expiation for killing, atonement for murder or manslaughter View this entry on the original dictionary page scan.
vadharn. (only this form) a destructive weapon (especially the thunderbolt of indra-) View this entry on the original dictionary page scan.
vadharatamfn. fond of killing View this entry on the original dictionary page scan.
vadhārhamfn. deserving death View this entry on the original dictionary page scan.
vadharyaNom. P. y/ati-, to hurl a thunderbolt (only f.of pr. p. vadhary/antī-,"casting a bolt", prob. = lightning) View this entry on the original dictionary page scan.
vadhāśaṅkam. or n. () View this entry on the original dictionary page scan.
vadhāśaṅkāf. () fear of death or destruction. View this entry on the original dictionary page scan.
vadhasnam. or n. (only in instrumental case plural) equals v/adhar- View this entry on the original dictionary page scan.
vadhasnumfn. wielding a deadly weapon View this entry on the original dictionary page scan.
vadhasthalīf. View this entry on the original dictionary page scan.
vadhasthānan. a place of execution View this entry on the original dictionary page scan.
vadhasthānan. a slaughter-house View this entry on the original dictionary page scan.
vadhatramfn. (for 2. v/adhatra-See below) protecting from death or destruction View this entry on the original dictionary page scan.
vadhatran. (for 1. vadha-tr/a-See under vadh/a-above),"instrument of death" , deadly weapon, dart View this entry on the original dictionary page scan.
vadhikam. or n. musk View this entry on the original dictionary page scan.
vadhinmfn. incurring death, killed by (in fine compositi or 'at the end of a compound') View this entry on the original dictionary page scan.
vadhiraSee badhira-. View this entry on the original dictionary page scan.
vadhitran. sexual love or the god of love View this entry on the original dictionary page scan.
vadhnam. plural Name of a people (Bombay edition vadhra-). View this entry on the original dictionary page scan.
vadhodarkamfn. resulting in death View this entry on the original dictionary page scan.
vadhodyatamfn. prepared or ready to kill, murderous View this entry on the original dictionary page scan.
vadhodyatam. an assassin, murderer View this entry on the original dictionary page scan.
vadhopāyam. an instrument or means of putting to death View this entry on the original dictionary page scan.
vadhramn. (also written badhra-; see bandh-) a leathern strap or thong, View this entry on the original dictionary page scan.
vadhraf. (prob.) a slice of bacon (See varāha-v-) View this entry on the original dictionary page scan.
vadhran. lead
vadhrakan. lead View this entry on the original dictionary page scan.
vadhraśva varia lectio for vadhry-aśva-. View this entry on the original dictionary page scan.
vadhrimfn. "one whose testicles are cut out", castrated, emasculated, unmanly (opp. to vṛṣan-) View this entry on the original dictionary page scan.
vadhrīf. (also written vaddhrī-) idem or 'mn. (also written badhra-; see bandh-) a leathern strap or thong, ' View this entry on the original dictionary page scan.
vadhrikām. a castrated person, eunuch on View this entry on the original dictionary page scan.
vadhrimatīf. a woman who has an impotent husband View this entry on the original dictionary page scan.
vadhrivāc(v/adhri--) mfn. speaking unmanly or useless words, idly talking View this entry on the original dictionary page scan.
vadhryam. (also written badhrya-) a shoe, slipper View this entry on the original dictionary page scan.
vadhryaśvam. "having castrated horses", Name of a man etc. (in he has the patronymic anūpa-) View this entry on the original dictionary page scan.
vadhryaśvam. plural the family of vādhry-aśva- (see vādhryaśva-and bradhnaśva-). View this entry on the original dictionary page scan.
vadhūf. (fr. vadh- equals vah-; see ūḍhā-) a bride or newly-married woman, young wife spouse any wife or woman etc. View this entry on the original dictionary page scan.
vadhūf. a daughter-in-law View this entry on the original dictionary page scan.
vadhūf. any younger female relation etc. View this entry on the original dictionary page scan.
vadhūf. the female of any animal, (especially) a cow or mare View this entry on the original dictionary page scan.
vadhūf. (see vadh/ū-mat-) View this entry on the original dictionary page scan.
vadhūf. Name of various plants (Trigonella Corniculata;Echites Frutescens;Curcuma Zerumbet) View this entry on the original dictionary page scan.
vadhuf. a young wife or woman. View this entry on the original dictionary page scan.
vadhuf. a daughter. in-law View this entry on the original dictionary page scan.
vadhūdarśamfn. looking at a bride View this entry on the original dictionary page scan.
vadhūdhanan. a wife's private property View this entry on the original dictionary page scan.
vadhūgṛhapraveśam. the ceremony of the entrance of a bride into the house of her husband View this entry on the original dictionary page scan.
vadhūjanam. a woman or wife (also collectively,"women") View this entry on the original dictionary page scan.
vadhukāf. a young woman or wife View this entry on the original dictionary page scan.
vadhūka(in fine compositi or 'at the end of a compound') equals vadhū-, a wife (see sa-v-). View this entry on the original dictionary page scan.
vadhūkālam. the time during which a woman is held to be a bride View this entry on the original dictionary page scan.
vadhūmat(vadh/ū--) mfn. (prob.) drawn by mares View this entry on the original dictionary page scan.
vadhūpatham. the path or way of a bride View this entry on the original dictionary page scan.
vadhūpraveśam. equals -griha-pr- View this entry on the original dictionary page scan.
vadhūsaṃyānan. a woman's vehicle View this entry on the original dictionary page scan.
vadhūsarāf. Name of a river (fabled to have sprung from the weeping eyes of puloma-, wife of bhṛgu-) View this entry on the original dictionary page scan.
vadhūsarākṛśāhvayāf. idem or 'f. Name of a river (fabled to have sprung from the weeping eyes of puloma-, wife of bhṛgu-) ' View this entry on the original dictionary page scan.
vadhuṭīf. a young woman living in her father's house View this entry on the original dictionary page scan.
vadhuṭīf. a daughter-in-law View this entry on the original dictionary page scan.
vadhūṭīf. idem or 'f. a young wife or woman ' View this entry on the original dictionary page scan.
vadhūṭīf. a daughter-in-law View this entry on the original dictionary page scan.
vadhūṭikāf. a young wife or woman View this entry on the original dictionary page scan.
vadhūṭīśayanan. "resting-place of women", a lattice, window View this entry on the original dictionary page scan.
vadhūtvan. condition of a bride View this entry on the original dictionary page scan.
vadhūvaran. sg. or m. plural bride and bridegroom, a newly-married couple View this entry on the original dictionary page scan.
vadhūvaram. plural brides and bridegroom View this entry on the original dictionary page scan.
vadhūvāsasn. a bride's undergarment View this entry on the original dictionary page scan.
vadhūvastran. bridal apparel View this entry on the original dictionary page scan.
vadhūyāna1. n. a woman's vehicle, View this entry on the original dictionary page scan.
vadhūyumfn. one who loves his wife or longs for a wife, uxorious, lustful, a wooer, suitor, bridegroom View this entry on the original dictionary page scan.
vadhūyu according to to some also,"a paramour". View this entry on the original dictionary page scan.
vadhvāind. gaRa cādi-. View this entry on the original dictionary page scan.
vadhvaṭīf. vaihūṭī- View this entry on the original dictionary page scan.
vadhyamfn. (frequently written b/adhya-) to be slain or killed, to be capitally punished, to be corporally chastised (see under vadha-), sentenced, a criminal etc. View this entry on the original dictionary page scan.
vadhyamfn. to be destroyed or annihilated etc. View this entry on the original dictionary page scan.
vadhyam. an enemy View this entry on the original dictionary page scan.
vadhyāf. See below.
vadhyāf. killing, murder (See atma--and brahma-v-). View this entry on the original dictionary page scan.
vadhyabhū f. a place of public execution, View this entry on the original dictionary page scan.
vadhyabhūmif. a place of public execution, View this entry on the original dictionary page scan.
vadhyacihnan. the mark or attribute of one sentenced to be killed View this entry on the original dictionary page scan.
vadhyadiṇḍimam. or n. (?) a drum beaten at the time of the execution of a criminal View this entry on the original dictionary page scan.
vadhyaghātaka() mfn. killing one sentenced to death, executing criminals. View this entry on the original dictionary page scan.
vadhyaghna() mfn. killing one sentenced to death, executing criminals. View this entry on the original dictionary page scan.
vadhyamālāf. a garland placed on the head of one sentenced to death View this entry on the original dictionary page scan.
vadhyapālam. "guardian of criminals", a jailer View this entry on the original dictionary page scan.
vadhyaparyāyam. (a hangman's) turn to execute a criminal View this entry on the original dictionary page scan.
vadhyapaṭam. the red garment of a criminal during his execution, View this entry on the original dictionary page scan.
vadhyapaṭaham. equals -diṇḍima- View this entry on the original dictionary page scan.
vadhyaśilāf. a stone or rock on which malefactors are executed, scaffold, slaughter-house, shambles View this entry on the original dictionary page scan.
vadhyaśilāf. Name of work View this entry on the original dictionary page scan.
vadhyasrajf. equals -mālā- View this entry on the original dictionary page scan.
vadhyasthānan. equals -bhū- View this entry on the original dictionary page scan.
vadhyatmfn. equals vadhyamāna-, being struck or killed View this entry on the original dictionary page scan.
vadhyatāf. View this entry on the original dictionary page scan.
vadhyatvan. the state of being sentenced to death, fitness to be killed View this entry on the original dictionary page scan.
vadhyavāsasn. the clothes of a criminal who has been executed (given to a caṇḍāla-) View this entry on the original dictionary page scan.
vadhyoṣam. Name of a man in gaRa bidādi- on (see badhyoga-). View this entry on the original dictionary page scan.
vadiind. (gaRa svar-ādi-; according to to some for badi-,contracted fr. bahula-dina-,but see vadya-) in the dark half of any month (affixed to the names of months in giving dates;See vaiśākha-v-). View this entry on the original dictionary page scan.
vadiṣṭhamfn. speaking best or very well View this entry on the original dictionary page scan.
vaditavyamfn. to be said or spoken (n. impersonal or used impersonally) View this entry on the original dictionary page scan.
vaditosSee vad- above. View this entry on the original dictionary page scan.
vaditṛmfn. speaking, saying, telling (with accusative) View this entry on the original dictionary page scan.
vaditṛm. a speaker (with genitive case) View this entry on the original dictionary page scan.
vadmanmfn. speaking, a speaker (said of agni-) View this entry on the original dictionary page scan.
vadyamfn. to be spoken etc. (See a-v-and anav-) View this entry on the original dictionary page scan.
vadyamfn. Name of the days of the dark lunar fortnight View this entry on the original dictionary page scan.
vadyan. speech, speaking about, conversing (See brahma-v-, satya-v-). View this entry on the original dictionary page scan.
vadyapakṣam. the dark fortnight of the lunar month (in which the moon is waning) View this entry on the original dictionary page scan.
abhavadīyamfn. not belonging to your Honour View this entry on the original dictionary page scan.
abhinirvadto declare with regard to (accusative) View this entry on the original dictionary page scan.
abhiparāvadto speak to, address View this entry on the original dictionary page scan.
abhivadP. (rarely A1. exempli gratia, 'for example' ) to address or salute with reverence etc. ; to declare with reference to, express by, name, call etc. ; to say, speak : Causal -vādayati-, te-, to address or salute reverently ; to present one's self to (dative case) : A1. to salute through another person (accusative or instrumental case) commentator or commentary P. to cause to recite ; "to cause to sound", play (on an instrument) View this entry on the original dictionary page scan.
abhivadanan. salutation View this entry on the original dictionary page scan.
abhivadanan. addressing commentator or commentary on View this entry on the original dictionary page scan.
abhivadh(Aorist -avadhīt-) to strike View this entry on the original dictionary page scan.
abhyanuvadP. (equals abhy-anu-vac-) to utter with reference to (accusative) View this entry on the original dictionary page scan.
abhyativadP. (equals ati-vad- q.v) "to speak louder or better", surpass in disputing View this entry on the original dictionary page scan.
abhyavadāto place into (locative case) View this entry on the original dictionary page scan.
abhyavadāto cut off in addition to View this entry on the original dictionary page scan.
abhyavadānya(or -d/ānya-) mfn. depriving of (genitive case) View this entry on the original dictionary page scan.
abhyāvadh(Aorist -āvadhīt-) to strike (varia lectio) View this entry on the original dictionary page scan.
abhyavadhā(perf. Passive voice p. -hita-) to allay, lay (as dust) View this entry on the original dictionary page scan.
abhyavadugdhamfn. that upon which milk has been milked View this entry on the original dictionary page scan.
acchāvadto salute View this entry on the original dictionary page scan.
adhivadto speak, pronounce over or at View this entry on the original dictionary page scan.
adhovadanamfn. equals adho-mukha-. View this entry on the original dictionary page scan.
adhvadarśinm. "way-indicator", a leader, guide, View this entry on the original dictionary page scan.
ādinavadarśamfn. having in view (another's) misfortune View this entry on the original dictionary page scan.
advaitavadinm. (also) Name (also title or epithet) of śaṃkara-, View this entry on the original dictionary page scan.
advaitavadinof buddha-, View this entry on the original dictionary page scan.
adyāvadhimfn. beginning or ending to-day View this entry on the original dictionary page scan.
adyāvadhimfn. from or till to-day. View this entry on the original dictionary page scan.
agrevadham. hitting or killing whatever is in front View this entry on the original dictionary page scan.
amaravadhū(), an apsaras- View this entry on the original dictionary page scan.
ambhojavadanāf. a lotus-faced woman, View this entry on the original dictionary page scan.
anārabhyavadam. a detached remark (upon sacrifices, etc.) View this entry on the original dictionary page scan.
anaśvadā(/an-/aśva--) mfn. one who does not give horses View this entry on the original dictionary page scan.
anavadānīya(or nīy/a-), f. not fit for distribution, View this entry on the original dictionary page scan.
anavadhānan. inattention, inadvertence View this entry on the original dictionary page scan.
anavadhānamfn. inattentive, careless. View this entry on the original dictionary page scan.
anavadhānatāf. inadvertency. View this entry on the original dictionary page scan.
anavadharṣya(6) mfn. not to be defied View this entry on the original dictionary page scan.
anavadhimfn. unlimited. View this entry on the original dictionary page scan.
anavadhṛṣyamfn. impossible to be put down or injured View this entry on the original dictionary page scan.
anavadrāṇamfn. ( drā-), not going to sleep, not sleepy View this entry on the original dictionary page scan.
anavadyamf(/ā-)n. irreproachable, faultless View this entry on the original dictionary page scan.
anavadyamf(/ā-)n. unobjectionable View this entry on the original dictionary page scan.
anavadyāf. Name of an apsaras-. View this entry on the original dictionary page scan.
anavadyāṅgamf(ī-)n. having faultless body or limbs. View this entry on the original dictionary page scan.
anavadyarūpa(anavady/a--) mf(ā-)n. of faultless form or beauty View this entry on the original dictionary page scan.
anavadyatāf. faultlessness. View this entry on the original dictionary page scan.
anavadyatvan. faultlessness. View this entry on the original dictionary page scan.
anekakālāvadhiind. long since. View this entry on the original dictionary page scan.
anṛtavadanan. speaking falsehood, lying. View this entry on the original dictionary page scan.
antarābhavadeham. the soul in its middle existence between death and regeneration. View this entry on the original dictionary page scan.
anupravadto repeat another's words ; to speak of : Causal -vādayati-, to cause to resound, to play (an instrument) View this entry on the original dictionary page scan.
anupūrvadaṃṣṭramfn. having regular hair, regularly shaped limbs, regular teeth, a regularly shaped navel, regular lines in the hands (all these are epithets given to buddha-, some of them also to mahāvīra-) and View this entry on the original dictionary page scan.
anupūrvadaṃṣṭratāf. having regular eye teeth (idem or 'mfn. having regular hair, regularly shaped limbs, regular teeth, a regularly shaped navel, regular lines in the hands (all these are epithets given to buddha-, some of them also to mahāvīra-) and '), ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
anuṣvadham(fr. sva-dhā-) ind. according to one's will, voluntary View this entry on the original dictionary page scan.
anuvadP. (with accusative) to repeat the words of ; to imitate (in speaking) ; to resound ; to repeat, insist upon ; (according to ,also A1.if without object or followed by a Gen.) Passive voice (anūdyate-) to be expressed correspondingly ; see anudita- sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
anvadhiruhto ascend after another View this entry on the original dictionary page scan.
anvadhyasto throw upon after another View this entry on the original dictionary page scan.
anvadhyāyamind. according to the chapters (of the veda-), according to the sacred texts View this entry on the original dictionary page scan.
anvavadhāto place into successively View this entry on the original dictionary page scan.
aparvadaṇḍam. a kind of sugar-cane. View this entry on the original dictionary page scan.
apavadP. to revile, abuse etc. ; to distract, divert, console by tales ; (in grammar) to except ; (A1.only) to disown, deny, contradict : Causal -vādayati-, to oppose as unadvisable ; to revile ; (in grammar) to except View this entry on the original dictionary page scan.
apavadamānamfn. reviling, speaking ill of (dative case) View this entry on the original dictionary page scan.
apavadh(Aorist -avadhīt-) to cut off, split ; to repel, avert View this entry on the original dictionary page scan.
aprasavadharminmfn. (in sāṃkhya- philosophy) not having the property of producing (one of the characteristics of puruṣa-) . View this entry on the original dictionary page scan.
apravadatmf(atī-)n. not roaring View this entry on the original dictionary page scan.
apriyamvadaSee apriya-vādin-. View this entry on the original dictionary page scan.
apriyaṃvada([ ]) mf(ā-)n. speaking unkindly or harshly. View this entry on the original dictionary page scan.
apūrvadarśanamfn. never seen before, View this entry on the original dictionary page scan.
āragvadham. the tree Cathartocarpus (Cassia) Fistula View this entry on the original dictionary page scan.
āragvadhan. its fruit View this entry on the original dictionary page scan.
āreavadyamfn. one from whom blame or insult is far removed View this entry on the original dictionary page scan.
ārgvadha equals āragvadha- q.v View this entry on the original dictionary page scan.
asāvadhānamfn. careless, inadvertent. View this entry on the original dictionary page scan.
asāvadhānatāf. carelessness. View this entry on the original dictionary page scan.
āsavadrum. Name of the Palmyra tree Borassus Flabelliformis (its juice, on fermenting, affords a spirituous liquor ) View this entry on the original dictionary page scan.
aśruvadanamf(ā-)n. tear-faced, View this entry on the original dictionary page scan.
aṣṭhīvaddaghnamfn. reaching up to the knee View this entry on the original dictionary page scan.
āsvadP. -svadati-, to eat, consume : Causal -svādayati-, to taste, enjoy, eat with a relish View this entry on the original dictionary page scan.
aśvadamfn. giving horses View this entry on the original dictionary page scan.
aśvadāmfn. equals -da- q.v (see /an-aśva-dā-.) View this entry on the original dictionary page scan.
aśvadaṃṣṭrāf. (equals śva-daṃṣṭrā- q.v) the plant Tribulus Lanuginosus View this entry on the original dictionary page scan.
aśvadāvanmfn. idem or 'mfn. intending to present with a horse, ' (vocative case) View this entry on the original dictionary page scan.
aśvadāyamfn. intending to present with a horse, View this entry on the original dictionary page scan.
aśvadevam. Name (also title or epithet) of a poet, View this entry on the original dictionary page scan.
asvadharmam. neglect of one's duty, diś-. View this entry on the original dictionary page scan.
aśvadhāṭīf. Name (also title or epithet) of a poem by jagannātha- paṇḍita-rāja- View this entry on the original dictionary page scan.
asvaditamfn. not made agreeable to the taste or sweet View this entry on the original dictionary page scan.
asvadṛśmfn. not seeing one's self or soul View this entry on the original dictionary page scan.
aśvadūtam. a messenger on horseback View this entry on the original dictionary page scan.
aśvadvādaśamf(ā-)n. plural (eleven cows and) a horse as the twelfth, View this entry on the original dictionary page scan.
aśvavadanam. plural Name of a people, View this entry on the original dictionary page scan.
ativadto speak louder or better, to surpass or overpower in disputing etc. ; to ask for too much View this entry on the original dictionary page scan.
ātmavadham. suicide View this entry on the original dictionary page scan.
ātmavadhyāf. idem or 'm. suicide ' View this entry on the original dictionary page scan.
aurdhvadaihikamfn. equals aurdhvadehika- View this entry on the original dictionary page scan.
aurdhvadehamfn. (fr. ūrdhva-deha-), relating or referring to the state after death, relating to future life View this entry on the original dictionary page scan.
aurdhvadehikamfn. idem or 'mfn. (fr. ūrdhva-deha-), relating or referring to the state after death, relating to future life ' View this entry on the original dictionary page scan.
aurdhvadehikamfn. relating to a deceased person, performed in honour of the dead, funereal, funeral View this entry on the original dictionary page scan.
aurdhvadehikan. the obsequies of a deceased person, any funeral ceremony View this entry on the original dictionary page scan.
aurdhvadehikan. whatever is offered or performed on a person's decease (as burning of the body, offering cakes, distributing alms etc.) View this entry on the original dictionary page scan.
aurdhvadehikakalpavallif. Name of work View this entry on the original dictionary page scan.
aurdhvadehikanirṇayam. Name of work View this entry on the original dictionary page scan.
aurdhvadehikapaddhatif. Name of work View this entry on the original dictionary page scan.
aurdhvadehikaprayogam. Name of work View this entry on the original dictionary page scan.
aurvadahanam. the submarine fire View this entry on the original dictionary page scan.
āvadP. -vadati-, to speak to, address ; to shout out ; to invoke, celebrate View this entry on the original dictionary page scan.
avadagdhamfn. burnt down View this entry on the original dictionary page scan.
avadāgham. (gaRa nyaṅkv-ādi- q.v) View this entry on the original dictionary page scan.
avadah(imperfect tense 2. sg. /avādahas-) "to burn down from", expel from (ablative) with heat or fire ; (ind.p. -dahya-) to burn down, consume View this entry on the original dictionary page scan.
avadāham. "burning down", the root of the fragrant grass Andropogon Muricatus View this entry on the original dictionary page scan.
avadāheṣṭan. idem or 'm. "burning down", the root of the fragrant grass Andropogon Muricatus ' View this entry on the original dictionary page scan.
avadal -dalati-, to burst, crack asunder View this entry on the original dictionary page scan.
avadalitamfn. burst, cracked View this entry on the original dictionary page scan.
avadaṃśam. any pungent food (which excites thirst), stimulant View this entry on the original dictionary page scan.
avadānan. a great or glorious act, achievement (object of a legend ) (For 2. ava-d/āna-See avado-.) View this entry on the original dictionary page scan.
avadānan. cutting or dividing into pieces etc.
avadānan. a part, portion View this entry on the original dictionary page scan.
avadānan. equals ava-dāha- (See sub voce, i.e. the word in the Sanskrit order ava-dah-) View this entry on the original dictionary page scan.
avadānakalpalatāf. "storehouse of legends of buddha-'s life and acts", Name (also title or epithet) of a celebrated work, n. 1. View this entry on the original dictionary page scan.
āvadānikamfn. (fr. ava-dāna-), offered after being divided into pieces View this entry on the original dictionary page scan.
avadānīyan. particle or portion (of meat) View this entry on the original dictionary page scan.
avadantam. "not speaking", a baby View this entry on the original dictionary page scan.
avadānyamfn. (see abhy-avad-) "niggardly", (gaRa cārv-ādi- q.v) View this entry on the original dictionary page scan.
avadāram. "breaking through" accusative ram- with i-, to break or burst through View this entry on the original dictionary page scan.
avadārakamfn. splitting open id est digging (the earth) View this entry on the original dictionary page scan.
avadaraṇan. breaking (as a boil etc.), bursting, separating View this entry on the original dictionary page scan.
avadāraṇamfn. breaking, shattering in pieces View this entry on the original dictionary page scan.
avadāraṇan. breaking, shattering View this entry on the original dictionary page scan.
avadāraṇan. breaking open, bursting open View this entry on the original dictionary page scan.
avadāraṇan. "opening (the ground)", a spade or hoe View this entry on the original dictionary page scan.
avadāritamfn. rent or burst open View this entry on the original dictionary page scan.
avadatmfn. not speaking View this entry on the original dictionary page scan.
avadātamfn. ( das-), cleansed, clean, clear View this entry on the original dictionary page scan.
avadātamfn. , blameless, excellent etc., of white splendour, dazzling white View this entry on the original dictionary page scan.
avadātamfn. clear, intelligible View this entry on the original dictionary page scan.
avadātam. white colour View this entry on the original dictionary page scan.
avadātavasanamfn. "clothed in white", laical, View this entry on the original dictionary page scan.
avadattamfn. (1. dā-) View this entry on the original dictionary page scan.
avadāvadamfn. undisputed, uncontested View this entry on the original dictionary page scan.
avaday -dayate- (1. sg. -daye-) to give or pay a sum of money (for the purpose of silencing or keeping one off) View this entry on the original dictionary page scan.
avadeyamfn. to be divided commentator or commentary on View this entry on the original dictionary page scan.
āvadhP. (Aorist 3. sg. /āvadhīt- ) to shatter, crush. View this entry on the original dictionary page scan.
avadhamfn. ( vadh-), not hurting, innoxious, beneficent ([ ;"indestructible", ]) View this entry on the original dictionary page scan.
avadham. the not striking or hurting View this entry on the original dictionary page scan.
avadham. absence of murder View this entry on the original dictionary page scan.
avadhāP. (Aorist 3. plural -/adhuh- ;Imper. 2. sg. -dhehi-and perf. 3. plural -dadh/uh- ; ind.p. -dhāya-;rarely A1. exempli gratia, 'for example' perf. -dadhe- ) to place down, plunge into (locative case), deposit ; to place or turn aside : Passive voice (Imper. -dhīyatām-) to be applied or directed (as the mind) : Causal (Potential -dhāpayet-) to cause. to put into (locative case) View this entry on the original dictionary page scan.
avadham -dhamati- (said of spirituous liquor) to stir up (as the parts of the body) : Passive voice to shake, tremble, shudder View this entry on the original dictionary page scan.
avadhānan. attention, attentiveness, intentness , (see sāvadhana-.) View this entry on the original dictionary page scan.
avadhānafixing, fastening, View this entry on the original dictionary page scan.
avadhānatāf. ([ ]) ([ ]) attentiveness. View this entry on the original dictionary page scan.
avadhānatvan. ([ ]) attentiveness. View this entry on the original dictionary page scan.
avadhānavatmfn. attentive, , Scholiast or Commentator View this entry on the original dictionary page scan.
avadhānavattā(f.) View this entry on the original dictionary page scan.
avadhāninmfn. "attentive", (gaṇa- iṣṭādi-, q.v) View this entry on the original dictionary page scan.
avadhāram. accurate determination limitation View this entry on the original dictionary page scan.
avadhārakamfn. determining, bearing upon, meaning View this entry on the original dictionary page scan.
avadhārakamfn. restricting View this entry on the original dictionary page scan.
avadhāraṇa am- n. ascertainment, affirmation, emphasis View this entry on the original dictionary page scan.
avadhāraṇan. stating or holding with positiveness or assurance View this entry on the original dictionary page scan.
avadhāraṇan. accurate determination, limitation (of the sense of words), restriction to a certain instance or instances with exclusion of any other View this entry on the original dictionary page scan.
avadhāraṇamfn. restrictive View this entry on the original dictionary page scan.
avadhāraṇīyamfn. to be ascertained, determined or known, (an-- negative) View this entry on the original dictionary page scan.
avadhāraṇīyamfn. to be considered as ascertained or determined , to be restricted to (instrumental case) View this entry on the original dictionary page scan.
avadhārhamfn. not worthy of death View this entry on the original dictionary page scan.
avadhāritamfn. ascertained, known, certain, heard, learnt View this entry on the original dictionary page scan.
avadhāritamfn. (in fine compositi or 'at the end of a compound' with śreṇy-ādi-) "known as", (gaRa kṛtādi- q.v) View this entry on the original dictionary page scan.
avadhāritinmfn. (gaRa iṣṭād- q.v) View this entry on the original dictionary page scan.
avadharṣyaSee an-avadh-. View this entry on the original dictionary page scan.
avadhāryamfn. to be ascertained or known View this entry on the original dictionary page scan.
avadhāryamfn. "to be made out or understood" See dur-avadh-. View this entry on the original dictionary page scan.
avadhātavyan. impersonal or used impersonally to be attended to. View this entry on the original dictionary page scan.
avadhāv -dh/āvati- to run down drop down from (ablative) View this entry on the original dictionary page scan.
avadhesind. ablative until, up to, as far as, as long as (genitive case [ ],or in compound) View this entry on the original dictionary page scan.
avadheyan. equals -dhātavya- q.v View this entry on the original dictionary page scan.
avadhim. attention View this entry on the original dictionary page scan.
avadhim. a term, limit etc. View this entry on the original dictionary page scan.
avadhim. conclusion, termination etc. View this entry on the original dictionary page scan.
avadhim. surrounding district, environs, neighbourhood View this entry on the original dictionary page scan.
avadhim. a hole, pit View this entry on the original dictionary page scan.
avadhim. period, time View this entry on the original dictionary page scan.
avadhiind. until, up to (in compound) View this entry on the original dictionary page scan.
avadhī(imperfect tense -dīdhet-) to watch or lie in wait for (dative case)
avadhijñānan. "perception extending as far as the furthest limits of the world" id est the faculty of perceiving even what is not within the reach of the senses, Name of the third degree of knowledge View this entry on the original dictionary page scan.
avadhijñāninmfn. having the above knowledge View this entry on the original dictionary page scan.
avadhika(?), mfn. occurring after (compound), View this entry on the original dictionary page scan.
avadhimatmfn. limited, bounded View this entry on the original dictionary page scan.
avadhīr(ind.p. ava-- dhīraya-) to disregard, disrespect, repudiate View this entry on the original dictionary page scan.
avadhīraṇan. treating with disrespect, repudiating View this entry on the original dictionary page scan.
avadhīraṇāf. treating with disrespect, repudiating View this entry on the original dictionary page scan.
avadhīrinmfn. despising View this entry on the original dictionary page scan.
avadhīrinmfn. excelling View this entry on the original dictionary page scan.
avadhīritamfn. disrespected, disregarded, etc. View this entry on the original dictionary page scan.
avadhīritamfn. surpassed, excelled View this entry on the original dictionary page scan.
avadhīyamānamfn. (Passive voice p.) being confined within (accusative ;or locative case ) . View this entry on the original dictionary page scan.
avadhṛCaus. -dhārayati- (ind.p. dhārya-; Passive voice -dhāryate-) to consider, ascertain, determine accurately, limit, restrict etc., to hear, learn ; to conceive, understand, make out, become acquainted with ; to reflect upon, think of (accusative or a phrase with iti-), (ind.p. PrakritodhAria) etc. ; to communicate : Passive voice -dhriyate-, to be ascertained, be certain commentator or commentary on View this entry on the original dictionary page scan.
avadhramfn. innoxious, beneficent View this entry on the original dictionary page scan.
avadhraSee a-vadh/a-. View this entry on the original dictionary page scan.
avadhṛṣyaSee an-avadh-. View this entry on the original dictionary page scan.
avadhṛtamfn. ascertained, determined, certain, View this entry on the original dictionary page scan.
avadhṛtamfn. heard, learnt , understood, made out commentator or commentary on View this entry on the original dictionary page scan.
avadhṛtan. plural (in sāṃkhya- philosophy) the organs of senses View this entry on the original dictionary page scan.
avadhūVed. P. (Imper. 2. sg. -dhūnuhi-,2. plural -dhūnutā-) to shake off or out or down etc.: A1. (2. sg. -dhūnuṣ/e-; imperfect tense 2. sg. -dhūnuthās-; Aorist -adhūṣata-; perf. Potential -dudhuvīta-; parasmE-pada -dhūnvān/a-) to shake off (as enemies or evil spirits or anything disagreeable), frighten away : Causal (Potential -dhūnayet-) to shake View this entry on the original dictionary page scan.
avadhūkamfn. having no wife, View this entry on the original dictionary page scan.
avadhūlanan. (see dhūli-) scattering over, strewing View this entry on the original dictionary page scan.
avadhūlitamfn. scattered over, covered View this entry on the original dictionary page scan.
avadhūnanan. shaking, causing to shake View this entry on the original dictionary page scan.
avadhūnanan. agitation, shaking (of the earth) View this entry on the original dictionary page scan.
avadhūpitamfn. perfumed with incense (varia lectio) View this entry on the original dictionary page scan.
avadhūtamfn. shaken off (as evil spirits) View this entry on the original dictionary page scan.
avadhūtamfn. removed, shaken away etc. View this entry on the original dictionary page scan.
avadhūtamfn. discarded, expelled, excluded etc. View this entry on the original dictionary page scan.
avadhūtamfn. disregarded, neglected, rejected etc. View this entry on the original dictionary page scan.
avadhūtamfn. touched View this entry on the original dictionary page scan.
avadhūtamfn. shaken, agitated (especially as plants or the dust by the wind), fanned etc. View this entry on the original dictionary page scan.
avadhūtamfn. that upon which anything unclean has been shaken out or off (see avakṣuta-) View this entry on the original dictionary page scan.
avadhūtamfn. unclean View this entry on the original dictionary page scan.
avadhūtamfn. one who has shaken, off from himself worldly feeling and obligation, a philosopher (brahma-vid-) View this entry on the original dictionary page scan.
avadhūtam. Name of a śaiva- philosopher View this entry on the original dictionary page scan.
avadhūtan. rejecting, repudiating (= ) . View this entry on the original dictionary page scan.
avadhūtapraṇipātamf(ā-)n. rejecting an act of homage View this entry on the original dictionary page scan.
avadhūtaveṣamfn. "wearing unclean clothes"or"wearing the clothes of one who is rejected", or"having discarded clothes" View this entry on the original dictionary page scan.
avadhūya ind.p. shaking off, rejecting, discarding etc. View this entry on the original dictionary page scan.
avadhūyadisregarding commentator or commentary on View this entry on the original dictionary page scan.
avadhvaṃsA1. (perf. -dadhvase-) to be scattered or dispersed ; -dhvaṃsate-, to sprinkle, strew with (instrumental case) : Causal -dhvaṃsayati- idem or 'See a-vadh/a-.' View this entry on the original dictionary page scan.
avadhvaṃsam. sprinkling View this entry on the original dictionary page scan.
avadhvaṃsam. meal, dust View this entry on the original dictionary page scan.
avadhvaṃsam. abandoning View this entry on the original dictionary page scan.
avadhvaṃsam. despising, disrespect View this entry on the original dictionary page scan.
avadhvastamfn. sprinkled View this entry on the original dictionary page scan.
avadhvastamfn. spotted, stippled View this entry on the original dictionary page scan.
avadhvastamfn. abandoned View this entry on the original dictionary page scan.
avadhvastamfn. despised (see apa-dhvasta-.) View this entry on the original dictionary page scan.
avadhyamfn. not to be killed, inviolable View this entry on the original dictionary page scan.
avadhyaSee a-vadh/a-. View this entry on the original dictionary page scan.
avadhyai(perf. -dadhyau-)to think Ill of (accusative), disregard View this entry on the original dictionary page scan.
avadhyānan. disregard View this entry on the original dictionary page scan.
avadhyatā(avadhy/a--) f. inviolability View this entry on the original dictionary page scan.
avadhyātamfn. disregarded View this entry on the original dictionary page scan.
avadhyatvan. idem or '(avadhy/a--) f. inviolability ' View this entry on the original dictionary page scan.
avadhyāyinmfn. disregarding (in fine compositi or 'at the end of a compound')
avadhyeyamfn. to be disregarded View this entry on the original dictionary page scan.
avadihcl.2 P. -degdhi-, to besmear View this entry on the original dictionary page scan.
avadīp(parasmE-pada -dipyamāna-) to burst out in a flame : Causal to kindle View this entry on the original dictionary page scan.
avadīrṇamfn. torn, rent etc. View this entry on the original dictionary page scan.
avadīrṇamfn. melted, liquefied View this entry on the original dictionary page scan.
avadīrṇamfn. "bewildered" See bhayāvadīrṇa-. View this entry on the original dictionary page scan.
avadiś(Imper. 2. plural -didiṣṭana-) to show or practise (kindness etc.) : Causal (Aorist subjunctive 1. sg. -dediśam-) to inform View this entry on the original dictionary page scan.
avado -dyati- (ind.p. -dāya- ) Ved. to cut off, divide (especially the sacrificial cake and other objects offered in a sacrifice) etc. ; to cut into pieces ; (Aorist Potential A1.1. sg. -diṣīya-[derived fr. ava-dā-,"to present", by ];perhaps fr. ava-day-above) to appease, satisfy with (instrumental case) View this entry on the original dictionary page scan.
avadoham. milk View this entry on the original dictionary page scan.
avadohaSee ava-duh-. View this entry on the original dictionary page scan.
avadolam. swinging, (according to to Scholiast or Commentator nava-- d-). View this entry on the original dictionary page scan.
avadṝ(Aorist subjunctive -darṣat- Potential -driṇīyāt- ; ind.p. -dīrya- ) to split or force open, to rend or tear asunder: Causal (Potential -dārayet-; parasmE-pada -dārayat-) to cause to burst, rend or split : Passive voice -dīryate-, to be split, burst View this entry on the original dictionary page scan.
avadrai(future p. -drāsy/at-) to fall asleep (see an-avadrāṇ/a-.) View this entry on the original dictionary page scan.
avadraṅgaan earnest (?), View this entry on the original dictionary page scan.
avadraṅgaSee avaḍanga-. View this entry on the original dictionary page scan.
avadṛś Passive voice -dṛśyate-, to be inferred or inferrible View this entry on the original dictionary page scan.
avaduh(Aorist subjunctive A1.3. sg. -dhukṣata-) to give milk to (dative case) , 1 3. Causal -dohayati-, to pour over with milk View this entry on the original dictionary page scan.
avadyamfn. ()"not to be praised" , blamable, low, inferior View this entry on the original dictionary page scan.
avadyamfn. disagreeable View this entry on the original dictionary page scan.
avadyan. anything blamable, want, imperfection, vice etc. View this entry on the original dictionary page scan.
avadyan. blame, censure View this entry on the original dictionary page scan.
avadyan. shame, disgrace View this entry on the original dictionary page scan.
avadyabhīf. fear of vices or sin View this entry on the original dictionary page scan.
avadyagohanamfn. concealing imperfection View this entry on the original dictionary page scan.
avadyapaSee mith/o-avadya-pa-. View this entry on the original dictionary page scan.
avadyatmfn. (pr.p.) breaking off View this entry on the original dictionary page scan.
avadyavat(avady/a-.) mfn. disgraceful, lamentable View this entry on the original dictionary page scan.
avadyotakamfn. illustrating, making clear commentator or commentary on View this entry on the original dictionary page scan.
avadyotanan. illustrating View this entry on the original dictionary page scan.
avadyotinmfn. equals -dyotaka-. View this entry on the original dictionary page scan.
avadyutCaus. -dyotayati-, to illustrate, show, indicate, Comm. on View this entry on the original dictionary page scan.
avāgvadanamfn. having the face turned downwards View this entry on the original dictionary page scan.
avasvadvatmfn. united with the desirous one ([ ]) View this entry on the original dictionary page scan.
avavad(Aorist subjunctive 1. plural -vādiṣma-) to speak ill of or against (genitive case) (see dur-avavada-.) View this entry on the original dictionary page scan.
avavadanan. speaking ill of. on View this entry on the original dictionary page scan.
avavaditamfn. instructed, taught View this entry on the original dictionary page scan.
avavaditṛm. one who speaks finally, who gives the definitive opinion View this entry on the original dictionary page scan.
avayavadharmam. the property or quality of a part View this entry on the original dictionary page scan.
avivadiṣṇumfn. not causing dispute View this entry on the original dictionary page scan.
avyavadhānan. non-interruption, contiguity View this entry on the original dictionary page scan.
avyavadhānan. non-separation commentator or commentary on View this entry on the original dictionary page scan.
avyavadhānamfn. uninterrupted View this entry on the original dictionary page scan.
avyavadhānamfn. without a cover (as the ground) View this entry on the original dictionary page scan.
bābhravadānacyuta (b/ābhr-) m. plural gaRa kārta-kaujapa-. View this entry on the original dictionary page scan.
bahvadhyāyamfn. consisting of many chapters gaRa guṇādi-. View this entry on the original dictionary page scan.
bahvadhyayana() mfn. consisting of many chapters gaRa guṇādi-. View this entry on the original dictionary page scan.
bakavadham. "the killing of baka-", Name of (see ) . View this entry on the original dictionary page scan.
bālāsuravadham. Name of chapter of View this entry on the original dictionary page scan.
bāṇāsuravadham. the killing of the asura- bāṇa-, Name of work View this entry on the original dictionary page scan.
bāndhavadhurāf. a friendly turn, kindness, (equals mitra-kṛtya- Scholiast or Commentator) View this entry on the original dictionary page scan.
baṭukabhairavadīpadānan. Name of work View this entry on the original dictionary page scan.
bhadravadanam. "auspicious-faced", Name of bala-rāma- View this entry on the original dictionary page scan.
bhagavadin compound for vat-. View this entry on the original dictionary page scan.
bhagavadānandam. Name of an author View this entry on the original dictionary page scan.
bhagavadārādhanan. "propitiation of bhagavat-" View this entry on the original dictionary page scan.
bhagavadārādhanakramam. Name of work View this entry on the original dictionary page scan.
bhagavadārādhanasamarthanan. Name of work View this entry on the original dictionary page scan.
bhagavadarcanan. "worship of bhagavat- id est kṛṣṇa- " View this entry on the original dictionary page scan.
bhagavadarcanamāhātmyan. Name of chapter of View this entry on the original dictionary page scan.
bhagavadarcanaprastāvam. Name of chapter of View this entry on the original dictionary page scan.
bhagavadāśrayabhūtamfn. being the seat or resting-place of bhagavat- View this entry on the original dictionary page scan.
bhagavadbhakti(in the beginning of a compound),"devotion to bhagavat- or kṛṣṇa-" View this entry on the original dictionary page scan.
bhagavadbhakticandrikāf. Name of work View this entry on the original dictionary page scan.
bhagavadbhakticandrikollāsam. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktimāhātmyan. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktinirṇayam. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktirasāyaṇan. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktiratnāvalīf. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktisādhanan. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktisārasaṃgraham. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktistotran. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktitaraṃgiṇīf. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktivilāsam. Name of work View this entry on the original dictionary page scan.
bhagavadbhaktivivekam. Name of work View this entry on the original dictionary page scan.
bhagavadbhāskaram. Name of work (= bhagavanta-bh-). View this entry on the original dictionary page scan.
bhagavadbhaṭṭam. Name of the author of a commentator or commentary on the rasa-taraṃgiṇī- View this entry on the original dictionary page scan.
bhagavadbhāvakam. Name of the author of a commentator or commentary on View this entry on the original dictionary page scan.
bhagavaddāsam. Name of the author of a commentator or commentary on View this entry on the original dictionary page scan.
bhagavaddharmavarṇanan. Name of work View this entry on the original dictionary page scan.
bhagavaddhyānamuktāvalīf. Name of work View this entry on the original dictionary page scan.
bhagavaddhyānasopānan. Name of work View this entry on the original dictionary page scan.
bhagavaddṛśamf(ī-)n. resembling the Supreme View this entry on the original dictionary page scan.
bhagavaddrumam. " bhagavat-'s (id est Buddha's) tree", (prob.) the sacred fig-tree View this entry on the original dictionary page scan.
bhagavadgītāf. plural (sometimes with upaniṣad-;once n(ta-). ) " kṛṣṇa-'s song", Name of a celebrated mystical poem (interpolated in the where it forms an episode of 18 chapters , containing a dialogue between kṛṣṇa- and arjuna-, in which the Pantheism of the vedānta- is combined with a tinge of the sāṃkhya- and the later principle of bhakti-or devotion to kṛṣṇa- as the Supreme Being; see ) View this entry on the original dictionary page scan.
bhagavadgītābhāṣyan. Name of work View this entry on the original dictionary page scan.
bhagavadgītābhāṣyavivaraṇan. Name of work View this entry on the original dictionary page scan.
bhagavadgītābhāvaprakāśam. Name of work View this entry on the original dictionary page scan.
bhagavadgītābodhakan. Name of work View this entry on the original dictionary page scan.
bhagavadgītāgūḍhārthadīpikāf. Name of work View this entry on the original dictionary page scan.
bhagavadgītāhetunirṇayam. Name of work View this entry on the original dictionary page scan.
bhagavadgītālaghuvyākhyāf. Name of work View this entry on the original dictionary page scan.
bhagavadgītālakṣābharaṇan. Name of work View this entry on the original dictionary page scan.
bhagavadgītāmāhātmyan. Name of work View this entry on the original dictionary page scan.
bhagavadgītāprasthānan. Name of work View this entry on the original dictionary page scan.
bhagavadgītāpratipadan. Name of work View this entry on the original dictionary page scan.
bhagavadgītārahasyan. Name of work View this entry on the original dictionary page scan.
bhagavadgītārtharakṣāf. Name of work View this entry on the original dictionary page scan.
bhagavadgītārthasaṃgraham. Name of work View this entry on the original dictionary page scan.
bhagavadgītārthasāram. Name of work View this entry on the original dictionary page scan.
bhagavadgītārthastotran. Name of work View this entry on the original dictionary page scan.
bhagavadgītāsamaṅgalācāraślokapaddhatif. Name of work View this entry on the original dictionary page scan.
bhagavadgītāsāram. Name of work View this entry on the original dictionary page scan.
bhagavadgītāsārasaṃgraham. Name of work View this entry on the original dictionary page scan.
bhagavadgītāśayam. Name of work View this entry on the original dictionary page scan.
bhagavadgītātatparyan. Name of work View this entry on the original dictionary page scan.
bhagavadgītātatparyabodhikāf. Name of work View this entry on the original dictionary page scan.
bhagavadgītātatparyabodhinīf. Name of work View this entry on the original dictionary page scan.
bhagavadgītātatparyacandrikāf. Name of work View this entry on the original dictionary page scan.
bhagavadgītātatparyadīpikāf. Name of work View this entry on the original dictionary page scan.
bhagavadgītātatparyanirṇayam. Name of work View this entry on the original dictionary page scan.
bhagavadgītāṭīkāf. Name of work View this entry on the original dictionary page scan.
bhagavadgītāvivaraṇan. Name of work View this entry on the original dictionary page scan.
bhagavadgītāvyākhyāf. Name of work View this entry on the original dictionary page scan.
bhagavadgovindam. Name of a poet View this entry on the original dictionary page scan.
bhagavadguṇa(in the beginning of a compound),"the qualities or virtues of bhagavat-" View this entry on the original dictionary page scan.
bhagavadguṇadarpaṇam. Name of work View this entry on the original dictionary page scan.
bhagavadguṇasārasaṃgraham. Name of work View this entry on the original dictionary page scan.
bhagavadīyam. a worshipper of bhagavat- id est viṣṇu- or kṛṣṇa- ( bhagavadīyatva -tva- n.) View this entry on the original dictionary page scan.
bhagavadīyatvan. bhagavadīya
bhagavadrātam. Name of a man View this entry on the original dictionary page scan.
bhagavadudyamanāṭakan. Name of a play. View this entry on the original dictionary page scan.
bhagavadupanayanan. "initiation of bhagavat-", Name of work View this entry on the original dictionary page scan.
bhagavadvilāsaratnāvalīf. Name of work View this entry on the original dictionary page scan.
bhagavadviśeṣam. Name of a man View this entry on the original dictionary page scan.
bhagavadyauvanodgamam. Name of chapter of the kṛṣṇa-krīḍita-. View this entry on the original dictionary page scan.
bhāgavatatattvadīpam. Name of work View this entry on the original dictionary page scan.
bhāgavatatattvadipaprakāśāvaraṇabhaṅgam. Name of work View this entry on the original dictionary page scan.
bhagavattattvadipikāf. Name of work View this entry on the original dictionary page scan.
bhairavadattam. Name of various authors View this entry on the original dictionary page scan.
bhairavadīpadānan. Name of work View this entry on the original dictionary page scan.
bhairavadīpanan. Name of work View this entry on the original dictionary page scan.
bhaktivilāsatattvadīpikāf. bhaktivilāsa
bhāratabhāvadīpam. Name of work View this entry on the original dictionary page scan.
bhārgavadīpikāf. Name of work View this entry on the original dictionary page scan.
bhaṭṭācāryaśatāvadhānam. Name of rāghavendra- View this entry on the original dictionary page scan.
bhavadin compound for bhavat-. View this entry on the original dictionary page scan.
bhavadāf. Name of one of the mātṛ-s attending on skanda- View this entry on the original dictionary page scan.
bhavadāhārārthamind. for your food View this entry on the original dictionary page scan.
bhavadantyamf(ā-)n. having bhavat- at the end View this entry on the original dictionary page scan.
bhavadanyamfn. other than you View this entry on the original dictionary page scan.
bhāvadarśin wrong reading for bhāla-d-. View this entry on the original dictionary page scan.
bhavadārun. equals devadāru-, Pinus Deodora View this entry on the original dictionary page scan.
bhāvadāsam. Name of a man View this entry on the original dictionary page scan.
bhavadattam. Name of a man View this entry on the original dictionary page scan.
bhavadattam. of the author of Comms. on and View this entry on the original dictionary page scan.
bhavadbhīmfn. having fear present id est afraid View this entry on the original dictionary page scan.
bhavadbhūtabhavyeind. in present, past, and future View this entry on the original dictionary page scan.
bhavaddevam. Name of a man (for bhava-deva-?). View this entry on the original dictionary page scan.
bhavadevam. Name of various authors (also with paṇḍita kavi-, bāla-valabhī-bhujaṃga-, bhaṭṭa-and miśra-) View this entry on the original dictionary page scan.
bhāvadevīf. Name of a poetess View this entry on the original dictionary page scan.
bhāvadharmagaṇi m. Name of men View this entry on the original dictionary page scan.
bhāvadīpam. Name of work View this entry on the original dictionary page scan.
bhāvadīpikāf. Name of work View this entry on the original dictionary page scan.
bhavadīyamfn. your honour's, your View this entry on the original dictionary page scan.
bhavaduttaramind. with bhavat- at the end View this entry on the original dictionary page scan.
bhavadvacanan. your honour's speech View this entry on the original dictionary page scan.
bhavadvasu(bh/avad--) mfn. having wealth present id est wealthy, opulent View this entry on the original dictionary page scan.
bhavadvidhamfn. any one like your honour or like you View this entry on the original dictionary page scan.
bhavadvidhim. your honour's manner (id est the way in which you are treated) View this entry on the original dictionary page scan.
bhavadvirahanāman. the mere mention of separation from you View this entry on the original dictionary page scan.
bhāvadyotanikāf. Name of 2 works. View this entry on the original dictionary page scan.
bhayāvadīrṇamfn. bewildered with fear View this entry on the original dictionary page scan.
bhrātṛvadhūf. equals -jāyā- View this entry on the original dictionary page scan.
bhrūṇavadham. () the killing of an embryo. View this entry on the original dictionary page scan.
bhuvadin compound for vat- (prob. an old pr. p. of bhū-). View this entry on the original dictionary page scan.
bhuvadvasumfn. giving wealth (prob. a mistake of ,where read bhuvad-[for abhuvat-] v/asuḥ-).
bhuvadvat(bh/uvad--) mfn. giving prosperity (said of the āditya-s) View this entry on the original dictionary page scan.
bilvadaṇḍa m. "having a staff of bilva- wood"Name of śiva- View this entry on the original dictionary page scan.
bilvadaṇḍinm. "having a staff of bilva- wood"Name of śiva- View this entry on the original dictionary page scan.
bodhisattvāvadānakalpalatāf. Name of work View this entry on the original dictionary page scan.
brāhmaṇavadham. the murder of a Brahman View this entry on the original dictionary page scan.
brahmavada(or -vala-) m. plural Name of a Vedic school (prob. wrong reading) View this entry on the original dictionary page scan.
brahmavadaf. " brahmā-'s tendril or creeper", Name of an upaniṣad- (equals brahmānanda-vally-upaniṣad-) View this entry on the original dictionary page scan.
brahmavadalipif. a particular mode of writing View this entry on the original dictionary page scan.
brahmavadham. the murder of a Brahman View this entry on the original dictionary page scan.
brahmavadhyāf. idem or 'm. the murder of a Brahman ' View this entry on the original dictionary page scan.
brahmavadhyākṛtan. act of murdering a Brahman View this entry on the original dictionary page scan.
brahmavadyan. recitation of sacred texts View this entry on the original dictionary page scan.
brahmavadyan. equals brahmodya- View this entry on the original dictionary page scan.
brahmavadyamf(ā-)n. (in dyā-kathā-) View this entry on the original dictionary page scan.
brāhmīśāntyavadhānakramam. Name of work View this entry on the original dictionary page scan.
bṛhadvadham. manifold murder View this entry on the original dictionary page scan.
bṛhadvadham. murder of a Brahman View this entry on the original dictionary page scan.
cakravadgatimfn. turning like a wheel View this entry on the original dictionary page scan.
candravadanāf. a moon-faced woman View this entry on the original dictionary page scan.
cāruvadanaSee cārv-ad-. View this entry on the original dictionary page scan.
cārvadanamfn. having beautiful teeth (? or for ru-vad- equals -mukha-). View this entry on the original dictionary page scan.
citravadālam. the fish Silurus pelonius View this entry on the original dictionary page scan.
cūḍāpakṣāvadānan. Name of View this entry on the original dictionary page scan.
dāhavadānyamfn. burning intensely, View this entry on the original dictionary page scan.
dāhavadānyatā(f.) View this entry on the original dictionary page scan.
daivadāravamf(ī-)n. made of the tree deva-dāru- on being on it View this entry on the original dictionary page scan.
daivadarśaninm. plural the pupils of deva-darśana- gaRa śaunakādi-. View this entry on the original dictionary page scan.
daivadattamfn. (for 2.See 2. daiva-) given by fate or fortune, innate, natural, View this entry on the original dictionary page scan.
daivadattamf(ī-)n. being in the village deva-datta- View this entry on the original dictionary page scan.
daivadattam. plural the pupils of deva-datta-, Va1rtt. 5 (see deva-dattīya-) View this entry on the original dictionary page scan.
daivadattaśaṭhinm. pl. idem or 'm. plural the pupils of deva-datta-, Va1rtt. 5 (see deva-dattīya-)' gaRa śaunakādi- View this entry on the original dictionary page scan.
daivadattim. patronymic fr. deva-datta- View this entry on the original dictionary page scan.
daivadattikamf(ī-)n. relating to deva-datta- gaRa kāśy-ādi-. View this entry on the original dictionary page scan.
daivadīpam. "the heavenly lamp", the eye (see deva--, deha--). View this entry on the original dictionary page scan.
daivadoṣam. the fault or evil result of deeds, evil fate View this entry on the original dictionary page scan.
daivadurvipākam. the evil ripening of destiny through the effect of deeds done in the present or former births, Hit. View this entry on the original dictionary page scan.
dākṣiṇyavaddaramfn. having a kind wife View this entry on the original dictionary page scan.
daṃśavadanam. "sharp-beaked", a heron View this entry on the original dictionary page scan.
daṇḍavadham. "death by punishment", capital punishment View this entry on the original dictionary page scan.
daśamukhavadham. "slaughter of rāvaṇa-", Name of a poem (different from ) View this entry on the original dictionary page scan.
daśavadanam. equals -kaṇṭha- View this entry on the original dictionary page scan.
dāśvadhvaramfn. intent on sacrificial oblations View this entry on the original dictionary page scan.
dattāvadhānamfn. attentive , View this entry on the original dictionary page scan.
davadagdhakaName of a grass View this entry on the original dictionary page scan.
davadahanam. the fire in a burning forest (naka-, ) View this entry on the original dictionary page scan.
dāvadahanajvālākalāpayaNom. A1. yate-, to resemble the sheet of flame in a burning forest View this entry on the original dictionary page scan.
davadānan. setting fire on a forest View this entry on the original dictionary page scan.
devadaivatyamfn. "having the gods as deity", destined for the gods View this entry on the original dictionary page scan.
devadālīf. a kind of pumpkin View this entry on the original dictionary page scan.
devadālikā f. a kind of pumpkin View this entry on the original dictionary page scan.
devadamanīf. Name of a woman View this entry on the original dictionary page scan.
devadamanikā f. Name of a woman View this entry on the original dictionary page scan.
devadānīf. a kind of creeper (equals ghoṣakākṛti-) View this entry on the original dictionary page scan.
devadantinm. Name of śiva- (?) View this entry on the original dictionary page scan.
devadarśam. Name of a teacher of View this entry on the original dictionary page scan.
devadarśanamfn. seeing the gods, familiar with them View this entry on the original dictionary page scan.
devadarśanam. Name of nārada-, View this entry on the original dictionary page scan.
devadarśanam. of a Brahman View this entry on the original dictionary page scan.
devadarśanan. appearance of a god View this entry on the original dictionary page scan.
devadarśanin wrong reading for daiva-d-. View this entry on the original dictionary page scan.
devadarśīf. of a school of , View this entry on the original dictionary page scan.
devadarśinmfn. equals śana- View this entry on the original dictionary page scan.
devadarśinm. Name of a school of View this entry on the original dictionary page scan.
devadārumn. Pinus devadāru- or Deodar (also Avaria Longifolia and Erythrosylon Sideroxyloides) etc. View this entry on the original dictionary page scan.
devadārumayamf(ī-)n. made of its wood View this entry on the original dictionary page scan.
devadāruvanamāhātmyan. Name of work View this entry on the original dictionary page scan.
devadāsam. a servant of a monastery () View this entry on the original dictionary page scan.
devadāsam. Name of a merchant's son View this entry on the original dictionary page scan.
devadāsam. of the brother of śārṅgadhara-'s mother (also sa-deva-) View this entry on the original dictionary page scan.
devadāsam. of the son of a kālidāsa- View this entry on the original dictionary page scan.
devadāsam. of several authors View this entry on the original dictionary page scan.
devadāsīf. a temple Nach-girl View this entry on the original dictionary page scan.
devadāsīf. the wild citron tree View this entry on the original dictionary page scan.
devadattamfn. god-given etc. View this entry on the original dictionary page scan.
devadattam. Name of arjuna-'s conch-shell View this entry on the original dictionary page scan.
devadattam. of one of the vital airs (which is exhaled in yawning) View this entry on the original dictionary page scan.
devadattam. Name of a cousin (or younger brother) and opponent of gautama- buddha- View this entry on the original dictionary page scan.
devadattam. of a son of uru-śravas- and father of agni-veśya- View this entry on the original dictionary page scan.
devadattam. of a son of the Brahman govinda-datta- View this entry on the original dictionary page scan.
devadattam. of a son of hari-datta- View this entry on the original dictionary page scan.
devadattam. of a son of king jayadatta- View this entry on the original dictionary page scan.
devadattam. of several authors View this entry on the original dictionary page scan.
devadattam. of a nāga- View this entry on the original dictionary page scan.
devadattam. of a grāma- of the bāhīka-s View this entry on the original dictionary page scan.
devadattam. a common N. for men used in gr., philosophy etc. View this entry on the original dictionary page scan.
devadattāf. Name of the mother of deva-datta- who was the cousin of gautama- buddha- (See above) View this entry on the original dictionary page scan.
devadattaf. Name of a courtezan View this entry on the original dictionary page scan.
devadattakam. plural the party led by deva-datta- View this entry on the original dictionary page scan.
devadattamayamf(ī-)n. consisting of deva-datta- Va1rtt. 16 View this entry on the original dictionary page scan.
devadattikāf. diminutive for -datta-, Va1rtt. 4
devadatttacaramfn. formerly in the possession of deva-datta- View this entry on the original dictionary page scan.
devadatttāgrajam. "the elder brother of deva-datta-", Name of gautama- buddha- (see above) View this entry on the original dictionary page scan.
devadatttarūpyamfn. equals -cara-, View this entry on the original dictionary page scan.
devadatttaśatham. Name of a preceptor gaRa śaunakādi- in View this entry on the original dictionary page scan.
devadatttīyam. plural the pupils of deva-datta- Va1rtt. 5 View this entry on the original dictionary page scan.
devadevam. "the god of gods", Name of brahmā- View this entry on the original dictionary page scan.
devadevam. of rudra-- śiva-, 7324 View this entry on the original dictionary page scan.
devadevam. of viṣṇu-kṛṣṇa- View this entry on the original dictionary page scan.
devadevam. of gaṇeśa- View this entry on the original dictionary page scan.
devadevam. dual number brahmā- and śiva- View this entry on the original dictionary page scan.
devadevam. plural the Brahmans View this entry on the original dictionary page scan.
devadeveśam. "lord of the chiefs of the gods", Name of śiva- ; of indra-, View this entry on the original dictionary page scan.
devadeveśam. of viṣṇu-, View this entry on the original dictionary page scan.
devadevīf. Name of durgā- i View this entry on the original dictionary page scan.
devadhāmann. equals -gṛha- View this entry on the original dictionary page scan.
devadhānīf. "divine abode", Name of indra-'s city on the mānasottara- (east of meru-) View this entry on the original dictionary page scan.
devadhānyan. "god's grain", Andropogon Saccharatus, Andopogon Saccharatus, Holcus Saccharatus or Saccharatus Cernuum View this entry on the original dictionary page scan.
devadharam. (bhāgavatācārya-) Name of Scholiast or Commentator on View this entry on the original dictionary page scan.
devadharmam. religious duty or office View this entry on the original dictionary page scan.
devadharmanm. Name of a king View this entry on the original dictionary page scan.
devadhiṣṇyan. seat (i .e. chariot) of a god View this entry on the original dictionary page scan.
devadhiṣṇyan. bdellium View this entry on the original dictionary page scan.
devadhūpam. "divine incense", the resin of Shorea Robusta View this entry on the original dictionary page scan.
devadiṇṇam. corrupt form for -datta- View this entry on the original dictionary page scan.
devadinnam. idem or 'm. corrupt form for -datta- ' , Name of a son of devadatta- View this entry on the original dictionary page scan.
devadīpam. "divine lamp", the eye View this entry on the original dictionary page scan.
devadroṇīf. an idol procession (originally ablution; see droṇī-) View this entry on the original dictionary page scan.
devadroṇīf. Phlomis Ceylanica View this entry on the original dictionary page scan.
devadryacmf(/īcī-) turned towards the gods View this entry on the original dictionary page scan.
devadundubhim. "divine drum", holy basil with red flowers View this entry on the original dictionary page scan.
devadundubhim. Name of indra- View this entry on the original dictionary page scan.
devadurgamfn. inaccessible to the gods View this entry on the original dictionary page scan.
devadūtam. divine messenger etc. (also taka- ) View this entry on the original dictionary page scan.
devadutīf. female messenger of the gods View this entry on the original dictionary page scan.
devadutīf. the wild citron tree View this entry on the original dictionary page scan.
devadūti wrong reading for -hūti-. View this entry on the original dictionary page scan.
devadyumnam. "glory of the gods", Name of a prince (son of devatā-jit- and father of parame-ṣṭhin-) View this entry on the original dictionary page scan.
devāntakavadham. "destruction of deva-datta-", Name of 71st chapter of View this entry on the original dictionary page scan.
devavadham. a weapon of the gods View this entry on the original dictionary page scan.
dhanvadhim. a bow-case View this entry on the original dictionary page scan.
dhanvadurgamfn. See dhanur-d-. View this entry on the original dictionary page scan.
dhenukavadham. the killing of dhenuka- View this entry on the original dictionary page scan.
dhenukavadham. Name of chapter of View this entry on the original dictionary page scan.
dhruvadevīf. Name of a princess View this entry on the original dictionary page scan.
dhūmavadgatimfn. moving like smoke View this entry on the original dictionary page scan.
dhvajavadam. Name of a man gaRa tikādi- View this entry on the original dictionary page scan.
digvadhūf. equals -aṅganā- View this entry on the original dictionary page scan.
dīnavadanamfn. equals -mukha- View this entry on the original dictionary page scan.
divadarśam. plural Name of a school of View this entry on the original dictionary page scan.
divyasūriprabhāvadīpikāf. Name of work View this entry on the original dictionary page scan.
divyāvadānan. "divine achievements", Name of a well-known Buddhist work from Nepal (written in Sanskrit). View this entry on the original dictionary page scan.
drāṅgavadham. Name of a man View this entry on the original dictionary page scan.
dravadaśvamfn. drawn by swift horses, View this entry on the original dictionary page scan.
dravadravyan. a fluid substance View this entry on the original dictionary page scan.
dundubhivadham. Name of the 89th chapter of the View this entry on the original dictionary page scan.
duravadhārakamfn. deciding or judging badly View this entry on the original dictionary page scan.
duravadhāraṇamfn. difficult to be defined, View this entry on the original dictionary page scan.
duravadhāryamfn. difficult to be understood View this entry on the original dictionary page scan.
duravavadan. (impersonal or used impersonally) difficult to speak ill of (genitive case) View this entry on the original dictionary page scan.
dūrevadhamfn. far-striking View this entry on the original dictionary page scan.
durvadakamfn. speaking badly, stammering View this entry on the original dictionary page scan.
dvadaśāramfn. having 12-spokes (as the wheel or cycle of the year) View this entry on the original dictionary page scan.
dvaṃdvaduḥkhan. pain arising from opposite alternations (as heat and cold etc.) View this entry on the original dictionary page scan.
dvijadevadevam. "god among Brahman", a very pious or excellent Brahman View this entry on the original dictionary page scan.
dyuvadhūf. equals -yoṣit- View this entry on the original dictionary page scan.
ekavadbhāvam. the being or becoming like one, aggregation commentator or commentary on View this entry on the original dictionary page scan.
etadavadhiind. to this limit, so far. View this entry on the original dictionary page scan.
etāvad(by saṃdhi- for et/āvat-). View this entry on the original dictionary page scan.
etāvadāvāsamfn. having so many abodes, View this entry on the original dictionary page scan.
etāvaddhāind. so many fold View this entry on the original dictionary page scan.
evāvadam. (fr. 1. eva-and ā-vad- ?), Name of a ṛṣi- ([ ]) View this entry on the original dictionary page scan.
gajavadanam. equals -mukha- View this entry on the original dictionary page scan.
gajavadhūf. a female elephant, View this entry on the original dictionary page scan.
gandharvadattāf. Name of a daughter of the gandharva- prince sāgara-datta-, . View this entry on the original dictionary page scan.
gandhavadhūf. equals -palāśī- View this entry on the original dictionary page scan.
gandhavadhūf. a kind of perfume View this entry on the original dictionary page scan.
gāṇḍīvadhanvanm. "having gāṇḍīva- for his bow", arjuna- View this entry on the original dictionary page scan.
gāṇḍivadharam. "holding the gāṇḍiva- bow", Name of arjuna- View this entry on the original dictionary page scan.
garbhavadham. killing of the embryo View this entry on the original dictionary page scan.
garbhavadhaprāyaścittan. penance for killing an embryo. View this entry on the original dictionary page scan.
gavadikam. plural See gabd-. View this entry on the original dictionary page scan.
ghoṣavadādimfn. beginning with a sonant, View this entry on the original dictionary page scan.
gopavadhūf. a cowherd's wife View this entry on the original dictionary page scan.
gopavadhūf. the gopā- plant View this entry on the original dictionary page scan.
gopavadhūṭīf. the youthful wife of a cowherd View this entry on the original dictionary page scan.
govadham. the killing of a cow View this entry on the original dictionary page scan.
gṛhapativadanan. a particular religious recitation, , Scholiast or Commentator View this entry on the original dictionary page scan.
grīvadaghnamfn. reaching up to the neck View this entry on the original dictionary page scan.
gucchavadhrāf. Name of a plant (guṇḍālā-) View this entry on the original dictionary page scan.
gudavadanan. the anus View this entry on the original dictionary page scan.
gudavadanāf. Name of a goddess View this entry on the original dictionary page scan.
gūḍhārthatattvadīpikāf. Name of commentary View this entry on the original dictionary page scan.
guhadavadyamfn. concealing deficiencies View this entry on the original dictionary page scan.
guṇavadvapusmfn. of excellent form, ibidem or 'in the same place or book or text' as the preceding View this entry on the original dictionary page scan.
guptāvadhūtamfn. one who has secretly shaken off from himself worldly obligation (opposed to vyaktāv-). View this entry on the original dictionary page scan.
guruvadvṛttif. behaving to any one with as much respect as to a sacred teacher View this entry on the original dictionary page scan.
hastivadham. the killing of an elephants (especially by a lion, which incurs the guilt of murder, whilst others carry off the spoils, such as the tusks and the pearls said to be found in the head) View this entry on the original dictionary page scan.
hastyaśvadīkṣāf. Name of the 16th and 17th pariśiṣṭa-s of the View this entry on the original dictionary page scan.
hāuyavadārasṛtand hāuhuvaivā-sāman- n. Name of sāman-s View this entry on the original dictionary page scan.
hayagrīvadaṇḍakan. Name of stotra-s View this entry on the original dictionary page scan.
hayagrīvavadham. Name of a poem by bhartṛ-meṇṭha- View this entry on the original dictionary page scan.
hetvavadhāraṇan. (in dramatic language) reasoning View this entry on the original dictionary page scan.
hiḍimbavadham. "the killing of hiḍimba-", an episode of the mahā-bhārata- . View this entry on the original dictionary page scan.
himavadgirim. a snowy mountain ( himavadgirisaṃśraya -saṃśraya- m."taking refuge in the himālaya-", Name of śiva-) View this entry on the original dictionary page scan.
himavadgirisaṃśrayam. himavadgiri
hiraṇyāśvadānan. Name of work View this entry on the original dictionary page scan.
hrasvadāf. the incense-producing tree (varia lectio hradā-) View this entry on the original dictionary page scan.
hrasvadarbham. equals -kuśa- View this entry on the original dictionary page scan.
hṛṣṭavadanamfn. merry-faced, having a cheerful countenance View this entry on the original dictionary page scan.
huvadhyai huvān/a- See hve-. View this entry on the original dictionary page scan.
induvadanamf(ā-)n. moon-faced View this entry on the original dictionary page scan.
induvadanāf. a metre of four verses (each of which contains fourteen syllables). View this entry on the original dictionary page scan.
iṣuvadham. death by an arrow View this entry on the original dictionary page scan.
jīvadin compound for vat-. View this entry on the original dictionary page scan.
jīvadam. "life-giver", a physician View this entry on the original dictionary page scan.
jīvadāf. equals vantī- View this entry on the original dictionary page scan.
jīvadam. "life-cutter", an enemy View this entry on the original dictionary page scan.
jīvadāmanm. Name of a prince. View this entry on the original dictionary page scan.
jīvadānan. "life-giving", Name of a manual of med. by cyavana- View this entry on the original dictionary page scan.
jīvadānu(v/a--) mfn. for jīr/a-d- View this entry on the original dictionary page scan.
jīvadaśāf. mortal existence View this entry on the original dictionary page scan.
jīvadātrīf. "life-giver" equals -bhadrā- View this entry on the original dictionary page scan.
jīvadātrīf. Coelogyne ovalis or Hoya viridiflora View this entry on the original dictionary page scan.
jīvadattam. Name of a man View this entry on the original dictionary page scan.
jīvadattakam. Name of a man View this entry on the original dictionary page scan.
jīvadāyakamfn. life-giving View this entry on the original dictionary page scan.
jīvadayāprakaraṇan. Name of a Jain treatise. View this entry on the original dictionary page scan.
jīvadbhartṛkāf. equals vapatnī- View this entry on the original dictionary page scan.
jīvadevam. Name of a man, View this entry on the original dictionary page scan.
jīvadhanan. live stock, wealth in flocks and herds View this entry on the original dictionary page scan.
jīvadhānīf. "receptacle of living beings", the earth View this entry on the original dictionary page scan.
jīvadhanya(v/a--) mf(ā-)n. rich in vital powers View this entry on the original dictionary page scan.
jīvadhanya according to to some,"blessing or befriending living creatures" View this entry on the original dictionary page scan.
jīvadvatsāf. equals va-tokā- View this entry on the original dictionary page scan.
jīvadvibhāgam. partition while (the father is still) living, View this entry on the original dictionary page scan.
jīvavadham. destruction of living beings View this entry on the original dictionary page scan.
kabandhavadham. "the slaying of kabandha-", Name of a chapter of the padma-purāṇa-. View this entry on the original dictionary page scan.
kadvadamfn. speaking ill or inaccurately or indistinctly etc. (with negative a- ) View this entry on the original dictionary page scan.
kadvadamfn. contemptible, vile, base View this entry on the original dictionary page scan.
kalamagopavadhūf. a woman employed to guard a rice-field View this entry on the original dictionary page scan.
kālavadanam. "black-faced", Name of a daitya- View this entry on the original dictionary page scan.
kālavadanam. (varia lectio śāla-v- ) View this entry on the original dictionary page scan.
kālāvadhim. a fixed period of time. View this entry on the original dictionary page scan.
kalavikalavadham. Name of a chapter of the gaṇeśa-purāṇa-. View this entry on the original dictionary page scan.
kalpadrumāvadānan. Name of a Buddhist work. View this entry on the original dictionary page scan.
kamalavadanamf(ā-)n. lotus-faced View this entry on the original dictionary page scan.
kamaṭhāsuravadham. "the slaying of the asura- kamaṭha-", Name of a section of the gaṇeśa-purāṇa-. View this entry on the original dictionary page scan.
kaṃjavadanan. a lotus-face (see vadanakaṃja-.) View this entry on the original dictionary page scan.
kaṃsavadham. "killing of kaṃsa-", Name of a drama by śeṣa-kṛṣṇa-. View this entry on the original dictionary page scan.
kaṅkavadanan. "heron's mouth", a pair of tongs View this entry on the original dictionary page scan.
kāṇvadevam. Name of a man. View this entry on the original dictionary page scan.
kapaṭadaityavadham. Name of a section of the gaṇeśa-purāṇa-. View this entry on the original dictionary page scan.
kapiśāvadānan. Name of a Buddhist work. View this entry on the original dictionary page scan.
karālavadanamfn. idem or 'mfn. having a terrible mouth ' View this entry on the original dictionary page scan.
karālavadanāf. Name of durgā-. View this entry on the original dictionary page scan.
karmāvaddnan. a great deed, exploit, View this entry on the original dictionary page scan.
karṇāvadhānan. giving ear to, listening to, attention (dhānam ava-dhā-,to pay attention, attend) . View this entry on the original dictionary page scan.
kaṭhināvadānan. Name of a Buddhist legend.
kavijanaśevadhi Name (also title or epithet) of a lexicon View this entry on the original dictionary page scan.
kāyavadham. Name of an asura- View this entry on the original dictionary page scan.
keśavadaivajñam. Name of an astronomer. View this entry on the original dictionary page scan.
keśavadāsam. Name of several authors. View this entry on the original dictionary page scan.
keśavadīkṣitam. Name of a man. View this entry on the original dictionary page scan.
kharadūṣaṇavadham. slaughter of those demons, Name of View this entry on the original dictionary page scan.
kīcakavadham. "the killing of kīcaka-", Name of a poem. View this entry on the original dictionary page scan.
kiṃvadantam. Name of an imp (inimical to children) View this entry on the original dictionary page scan.
kiṃvadantīf. ()"what do they say?" the common saying or rumour, report, tradition, tale View this entry on the original dictionary page scan.
kiṃvadantif. equals -vadantī- before View this entry on the original dictionary page scan.
kiṭivaravadanāf. Name of a deity View this entry on the original dictionary page scan.
klāntavadanamfn. having a weary face. View this entry on the original dictionary page scan.
kriyāvyavadhāyakamfn. interrupting an action View this entry on the original dictionary page scan.
kṛṣṇāvadātamfn. black and white View this entry on the original dictionary page scan.
kṛtāvadhānamfn. one who takes care, careful, cautious, attentive. View this entry on the original dictionary page scan.
kṛtāvadhimfn. having a fixed limit, fixed, appointed, agreed upon View this entry on the original dictionary page scan.
kṛtāvadhimfn. bounded, limited. View this entry on the original dictionary page scan.
kṛtavadhyacihnamfn. bearing the marks of death, View this entry on the original dictionary page scan.
kṣārapūrvadaśakan. a decade of acrid substances View this entry on the original dictionary page scan.
kṣullakavaiśvadevan. (see mahā-v-) View this entry on the original dictionary page scan.
kṣullakavaiśvadevam. a small cup for the vaiśvadeva-s, View this entry on the original dictionary page scan.
kulavadhūf. a virtuous wife, respectable woman View this entry on the original dictionary page scan.
kulavadhūtāf. virtue in a wife. View this entry on the original dictionary page scan.
kumbhakarṇavadham. "the slaughter of kumbhakarṇa-", Name of a section of the View this entry on the original dictionary page scan.
kumudinīvadhūvaram. idem or 'm. idem or 'm. (equals kumuda-bandhu-) the moon ' ' View this entry on the original dictionary page scan.
kuraṅgavadhūf. a female antelope View this entry on the original dictionary page scan.
kurvadrūpan. cause (according to the cārvāka-s) View this entry on the original dictionary page scan.
kuvadamfn. equals -vaca- View this entry on the original dictionary page scan.
kuvadhūf. a bad wife View this entry on the original dictionary page scan.
kvadhaḥsthamfn. (fr. 2. ku-),"standing below on the earth" (a wrong reading). View this entry on the original dictionary page scan.
kvadhastha according to to some read sadhastham-. View this entry on the original dictionary page scan.
līlāvadhūta(lāv-) mfn. gracefully waved about View this entry on the original dictionary page scan.
mādhavadāsaprob. wrong reading for mohana-d-. View this entry on the original dictionary page scan.
mādhavadevam. Name of various authors View this entry on the original dictionary page scan.
mādhavadrumam. Spondias Mangifera View this entry on the original dictionary page scan.
madhvadmfn. eating sweetness View this entry on the original dictionary page scan.
mahādevadaivajñam. Name of author. View this entry on the original dictionary page scan.
mahādevadīkṣitam. Name of author. View this entry on the original dictionary page scan.
mahādevadvivedinm. Name of author. View this entry on the original dictionary page scan.
mahāsattvavadham. the killing of a great creature or large animal View this entry on the original dictionary page scan.
mahāvadam. "speaker of great words", proclaimer or teacher of the highest Vedic knowledge () View this entry on the original dictionary page scan.
mahāvadham. (mah/ā--) a mighty or destructive weapon, destructive thunderbolt View this entry on the original dictionary page scan.
mahāvadhamfn. carrying a mighty weapon or destructive shaft View this entry on the original dictionary page scan.
mahāvaiśvadeva(mah/ā--) m. Name of a graha- (q.v) View this entry on the original dictionary page scan.
maitrāyaṇīyaurdhvadehikapaddhatif. Name of work View this entry on the original dictionary page scan.
malavadeśam. Name of a country View this entry on the original dictionary page scan.
mālavadeśam. the country of mālava- or Malwa View this entry on the original dictionary page scan.
malavadvāsasmfn. wearing dirty or impure clothes View this entry on the original dictionary page scan.
malavadvāsasf. a menstruous woman (see malodvāsas-). View this entry on the original dictionary page scan.
māṃsapiṇḍagṛhitavadanamfn. carrying a lump of flesh in the mouth View this entry on the original dictionary page scan.
mānavadevam. "god among men", a king, prince View this entry on the original dictionary page scan.
mānavadharmaśāstran. Name of the code of laws attributed to manu- (equals manusaṃhitā-). View this entry on the original dictionary page scan.
mañcakāsuradundubhivadham. Name of chapter of View this entry on the original dictionary page scan.
manobhavadrumam. love compared to a tree, View this entry on the original dictionary page scan.
māsatrayāvadhiind. for the space of three months View this entry on the original dictionary page scan.
māsāvadhikamfn. happening in the period of a month at the latest View this entry on the original dictionary page scan.
maṭhakesavadhāriṇīf. Name of nandā- (the founder of the college of keśava-) View this entry on the original dictionary page scan.
mātṛvadham. the murder of a mother (with Buddhists one of the 5 unpardonable sins ) . View this entry on the original dictionary page scan.
matsyāsuraśailavadham. Name of chapter of View this entry on the original dictionary page scan.
mervadrikarṇikāf. "having mount meru- for a seed-vessel", the earth View this entry on the original dictionary page scan.
mithoavadyapa(mith/o-av-) mfn. mutually averting calamities View this entry on the original dictionary page scan.
mithyāvadhyānukīrtanan. the proclaiming that any one has been unjustly sentenced to death View this entry on the original dictionary page scan.
mṛgavadhājīva m. "one who lives by killing wild animals", a huntsman View this entry on the original dictionary page scan.
mṛgavadhājīvinm. "one who lives by killing wild animals", a huntsman View this entry on the original dictionary page scan.
mṛgavadhūf. a female deer, doe View this entry on the original dictionary page scan.
mugdhavadhūf. a young and lovely woman View this entry on the original dictionary page scan.
muṣṭivadham. devastation of the crops View this entry on the original dictionary page scan.
nāgavadha(with rasa-) m. a remedy against leprosy for the preparation of which a snake is used View this entry on the original dictionary page scan.
nāgavadhūf. female elephant View this entry on the original dictionary page scan.
nandimukhasughoṣāvadānan. nandimukhasughoṣa
naradevadevam. god among kings, supreme sovereign View this entry on the original dictionary page scan.
naṣṭāśvadagdharathavatind. like one whose horse was lost and one whose waggon was burnt (who therefore helped each other) on Va1rtt. 16. View this entry on the original dictionary page scan.
navadalan. the fresh leaf of a lotus or any young leaf View this entry on the original dictionary page scan.
navadaśamf(ī-)n. the 19th View this entry on the original dictionary page scan.
navadaśamf(ī-)n. consisting of 19 View this entry on the original dictionary page scan.
navadaśanor (n/ava-.) View this entry on the original dictionary page scan.
navadaśanmfn. plural 19 View this entry on the original dictionary page scan.
navadāvam. recently burnt pasture land View this entry on the original dictionary page scan.
navadāvyamfn. growing on it View this entry on the original dictionary page scan.
navadevakulan. Name of a town View this entry on the original dictionary page scan.
navadhāind. into 9 parts, in 9 ways, 9 times etc. etc. View this entry on the original dictionary page scan.
navadīdhitim. "9- rayed", the planet Mars or its regent (see navārcis-). View this entry on the original dictionary page scan.
navadolāf. a litter borne by 9 men View this entry on the original dictionary page scan.
navadurgāf. durgā- in her 9 forms (viz. kumārikā-, tri-mūrti-, kalyāṇī- rohiṇī-, kālī-, caṇḍikā-, śāmbhavī-, durgā-, bhadrā-) View this entry on the original dictionary page scan.
navadvāran. plural the 9 doors or apertures (of the body; see 3. kh/a-) View this entry on the original dictionary page scan.
navadvāramfn. 9 doored etc. View this entry on the original dictionary page scan.
navadvāran. the body View this entry on the original dictionary page scan.
navadvīpam. "the new island", Name of a place now called Nuddea (at the confluence of the bhāgīrathī- and the Jalangi rivers) View this entry on the original dictionary page scan.
navadvīpaparikramāf. Name of work View this entry on the original dictionary page scan.
navavadhūf. equals next View this entry on the original dictionary page scan.
navavadhūf. a daughter-in-law View this entry on the original dictionary page scan.
nibandhatattvadīpam. Name of work View this entry on the original dictionary page scan.
nidāghāvadhim. the hot season View this entry on the original dictionary page scan.
niravadānan. ( ) allotment or distribution of shares. View this entry on the original dictionary page scan.
niravadayA1. -dayate-, to satisfy any one (accusative) with (accusative or instrumental case) or with respect to (ablative) View this entry on the original dictionary page scan.
niravadheP. -dhayati-, to suck out View this entry on the original dictionary page scan.
niravadhimfn. unlimited, View this entry on the original dictionary page scan.
niravadhimfn. endless, infinite (also dhika-). View this entry on the original dictionary page scan.
niravadoP. -dāti-, or -dyati- (ind.p. -dāya-), to distribute or divide completely, give any one his share, appease or satisfy with (double accusative) View this entry on the original dictionary page scan.
niravadoṣatvan. (?) View this entry on the original dictionary page scan.
niravadyamf(ā-)n. unblamable, unobjectionable etc. ( niravadyatva -tva- n. ) View this entry on the original dictionary page scan.
niravadyan. blamelessness, excellence ( niravadyavat -vat- mfn. ) View this entry on the original dictionary page scan.
niravadyan. or m. a particular high number View this entry on the original dictionary page scan.
niravadya -avayava- etc. See nir-, . View this entry on the original dictionary page scan.
niravadyatvan. niravadya
niravadyavatmfn. niravadya
nirvadP. A1. -vadati-, te- (Aorist -avādiṣam-, -vādiṣṭam-), to order off, warn off, expel or drive away ; to speak out, utter ; to abuse, revile ; to deny View this entry on the original dictionary page scan.
nirvadhto split off or asunder, sever, separate View this entry on the original dictionary page scan.
nirvyavadhānamfn. (ground) uncovered, bare View this entry on the original dictionary page scan.
nivad Causal A1. -vādayate-, to make resound (as a drum etc.)
nivadh(Aorist -avadhīt-), to strike down, kill etc. ; to fix in, hurl down upon (locative case) View this entry on the original dictionary page scan.
nyāyādhvadīpikāf. Name of work View this entry on the original dictionary page scan.
padmanābhadvadaśīf. Name of the 12th day in the light half of the month āśvayuja- View this entry on the original dictionary page scan.
pakṣavadham. "side stroke", paralysis of one side View this entry on the original dictionary page scan.
pallavadhārinmfn. bearing blossoms (as a flower) View this entry on the original dictionary page scan.
pallavadrum. the aśoka- tree View this entry on the original dictionary page scan.
pañcagavadhanamfn. one whose property consists of 5 cows View this entry on the original dictionary page scan.
pañcapādikāṭikātattvadīpanan. Name of Comm. View this entry on the original dictionary page scan.
pañcāvadānan. the offering (of the havis-) in 5 avadāna-s View this entry on the original dictionary page scan.
pañcavadanastotran. Name of a stotra- (see pañcavaktra-st-). View this entry on the original dictionary page scan.
paramasvadharmanmfn. most exact in the observance of the duties of one's own (caste or tribe) View this entry on the original dictionary page scan.
paramāvadhim. utmost term or limit View this entry on the original dictionary page scan.
paraśvadham. (in fine compositi or 'at the end of a compound' f(ā-).) a hatchet, axe (also written parasv-). View this entry on the original dictionary page scan.
pāraśvadha mf(ī-)n. (fr. paraśvadha-) armed with an axe (see ) . View this entry on the original dictionary page scan.
paraśvadhāyudhamfn. armed with an axe View this entry on the original dictionary page scan.
pāraśvadhikamf(ī-)n. (fr. paraśvadha-) armed with an axe (see ) . View this entry on the original dictionary page scan.
paraśvadhinmfn. furnished with an axe View this entry on the original dictionary page scan.
parāvadP. -vadati-, to warn off or remove by speaking or reciting View this entry on the original dictionary page scan.
pārāvadaghnī wrong reading for pārāvata-ghnī-. View this entry on the original dictionary page scan.
parāvadh(only Aorist -avadhīt-, -vadhīt-), to strike down, crush, tear (p/arā-parā vadhīt-) View this entry on the original dictionary page scan.
pariṇataśarvadf. the latter part of the autumn View this entry on the original dictionary page scan.
pāriplavadṛṣṭi () mfn. having tremulous or swimming eyes View this entry on the original dictionary page scan.
parisaṃvadP. -vadati-, to speak together about, agree with regard to (accusative) View this entry on the original dictionary page scan.
parivadP. -vadati-, to speak out, speak of or about (accusative) ; (also A1.) to speak ill of, revile, slander, accuse View this entry on the original dictionary page scan.
parivadanan. reviling, accusing, clamouring View this entry on the original dictionary page scan.
parivivadiṣumfn. (fr. Desiderative) wishing or trying to accuse others View this entry on the original dictionary page scan.
parivivadiṣuSee pari-vad-. View this entry on the original dictionary page scan.
pārśvadam. "turning the side towards another", an attendant View this entry on the original dictionary page scan.
pārśvadam. plural attendants, retinue (varia lectio pārṣada-). View this entry on the original dictionary page scan.
pārśvadāham. a burning pain in the side View this entry on the original dictionary page scan.
pārśvadeśam. the region of the side, the ribs View this entry on the original dictionary page scan.
pārśvadevam. Name of an author View this entry on the original dictionary page scan.
parśvadham. equals paraśvadha-, an axe, hatchet
pārśvadrumam. pl. the trees at the side or on every side View this entry on the original dictionary page scan.
parvadakṣiṇāf. the teacher's fee for teaching a particular portion of the veda- View this entry on the original dictionary page scan.
parvadhim. "period-container", the moon View this entry on the original dictionary page scan.
parvadivasam. the day of a periodic change of the moon View this entry on the original dictionary page scan.
parvāvadhim. a joint or knot View this entry on the original dictionary page scan.
parvāvadhim. a particular period, the end of a parvan- etc. View this entry on the original dictionary page scan.
paryavadānan. complete destruction or disappearance View this entry on the original dictionary page scan.
paryāvadānan. equals pary-ava-dāna- View this entry on the original dictionary page scan.
paryavadāpayitṛm. (fr. Causal) a distributor View this entry on the original dictionary page scan.
paryavadātamfn. ( dai-) perfectly clean or pure View this entry on the original dictionary page scan.
paryavadātamfn. very accomplished View this entry on the original dictionary page scan.
paryavadātamfn. well acquainted or conversant with (locative case) ( paryavadātatva -tva- n.) View this entry on the original dictionary page scan.
paryavadātamfn. well known, very familiar View this entry on the original dictionary page scan.
paryavadātaśrutamfn. perfectly skilled in art ( paryavadātaśrutatā -tā- f.) View this entry on the original dictionary page scan.
paryavadātaśrutatāf. paryavadātaśruta
paryavadātatvan. paryavadāta
paryavadhāraṇan. ( dhṛ-) precise determination, careful consideration, refining, subtilizing View this entry on the original dictionary page scan.
paryavadoP. -dyati-, to cut off or slice all round View this entry on the original dictionary page scan.
paśvavadānan. sacrifice or offering of animals View this entry on the original dictionary page scan.
paurvadaihikamfn. belonging to or derived from a former body or a, former existence, done in a former life View this entry on the original dictionary page scan.
paurvadehika mfn. belonging to or derived from a former body or a, former existence, done in a former life View this entry on the original dictionary page scan.
phullavadanamfn. "smiling-faced", looking pleased or happy View this entry on the original dictionary page scan.
piśācavadanamfn. having the face of a piśāca- View this entry on the original dictionary page scan.
pitṛvadhan. murder of a father, parricide View this entry on the original dictionary page scan.
pracaṇḍavadanamf(ā-)n. having a terrible face
prahasitavadanamfn. () with laughing face. View this entry on the original dictionary page scan.
prahṛṣṭavadanamfn. equals -mukha- View this entry on the original dictionary page scan.
pramlānavadanamfn. having a sickly-looking face View this entry on the original dictionary page scan.
pramuditavadanāf. Name of a metre View this entry on the original dictionary page scan.
praṇavadarpaṇam. Name of work View this entry on the original dictionary page scan.
prāṇivadham. slaughter of living beings View this entry on the original dictionary page scan.
prāṇivadhaprāyaścittan. Name of work View this entry on the original dictionary page scan.
praphullavadanamfn. having the face expanded with joy, looking gay or happy View this entry on the original dictionary page scan.
prasavadharmanmfn. subject to the condition of birth, View this entry on the original dictionary page scan.
prasavadharminmfn. characterized by production, productive, prolific View this entry on the original dictionary page scan.
prathamapravadamfn. uttering the first sound (as a child) View this entry on the original dictionary page scan.
pratisaṃvadA1. -vadate-, to agree with any one (accusative) View this entry on the original dictionary page scan.
pratiṣvad( svad-), Causal -ṣvādayati- to taste, relish View this entry on the original dictionary page scan.
prativadP. -vadati-, to speak to (acc) ; to speak back, answer, reply to (accusative) etc. ; to repeat : Intens.p. -vāvadat- (mfn.) contradicting View this entry on the original dictionary page scan.
prativadh(only Aorist -avadhīt-), to beat back, ward off View this entry on the original dictionary page scan.
prativaditavyamfn. to be contested or disputed, View this entry on the original dictionary page scan.
pratyabhivadP. -vadati-, to return a salute, greet in return : Causal A1. -vādayate- idem or 'n. ( likh-) a counter document, a document brought forward by the opposing party ' View this entry on the original dictionary page scan.
pratyāgamāvadhiind. till (my) return View this entry on the original dictionary page scan.
pratyaktattvadīpikāf. Name of work (or -pradīpikā-) View this entry on the original dictionary page scan.
pratyavadhāP. -dadhāti-, to put in again View this entry on the original dictionary page scan.
pratyavadoP. -dāt/i-, or -dyati-, to divide again View this entry on the original dictionary page scan.
pratyudvadCaus. -vādayati-, to cause to resound View this entry on the original dictionary page scan.
pravadin compound for vat-. View this entry on the original dictionary page scan.
pravadP. A1. -vadati-, te- (Ved. infinitive mood pr/a-vaditos-), to speak out, pronounce, proclaim, declare, utter, say, tell etc. ; to speak to (accusative) ; to raise the voice (said of birds and animals) ; to roar, splash (said of water) ; (see a-pravadat-) to assert, affirm, state ; to pronounce to be, call, name (2 accusative) etc. ; to offer for sale (with instrumental case of price) (varia lectio): Causal -vādayati-, to cause to sound, play (with accusative of the instrument) etc. ; (without an object) to play, make music (also -vādyati-,with act. meaning ) . View this entry on the original dictionary page scan.
pravadamfn. sounding forth, sounding (as a drum) View this entry on the original dictionary page scan.
pravadam. a herald, bard (?) View this entry on the original dictionary page scan.
pravadanan. a proclamation, announcement View this entry on the original dictionary page scan.
pravadbhārgavan. Name of a sāman- View this entry on the original dictionary page scan.
pravadh(only Passive voice proper 3. plural -vadhyante-and ind.p. -vadhya-), to kill or slay View this entry on the original dictionary page scan.
pravadiṣuSee vāk-pravadiṣu-. View this entry on the original dictionary page scan.
pravaditṛmfn. one who speaks out, uttering (genitive case or accusative) View this entry on the original dictionary page scan.
pravadyāman(v/ad--) mfn. having a downward path, rapid in its course (as a chariot)
preṣyavadhūf. a female servant, handmaid View this entry on the original dictionary page scan.
preṣyavadhūf. the wife of a slave View this entry on the original dictionary page scan.
priyaṃvadamf(ā-)n. speaking kindly, agreeable, affable to (genitive case or compound) etc. View this entry on the original dictionary page scan.
priyaṃvadam. a kind of bird View this entry on the original dictionary page scan.
priyaṃvadam. Name of a gandharva- View this entry on the original dictionary page scan.
priyaṃvadam. of a poet View this entry on the original dictionary page scan.
priyaṃvadāf. a kind of metre View this entry on the original dictionary page scan.
priyaṃvadam. Name of a woman View this entry on the original dictionary page scan.
priyaṃvadakam. Name of a man View this entry on the original dictionary page scan.
priyavadyan. equals -vāda- (q.v) View this entry on the original dictionary page scan.
puṃstvadoṣam. "want of manhood", impotence View this entry on the original dictionary page scan.
puṃvadvidhānan. ceremonies as on the birth of a male View this entry on the original dictionary page scan.
punaruktavadābhāsam. seeming tautology (a figure of speech) View this entry on the original dictionary page scan.
purastādvadanan. preface, introduction View this entry on the original dictionary page scan.
puravadhūf. equals -nār-ī- View this entry on the original dictionary page scan.
pūrṇāmṛtāṃśuvadanamfn. having a face like the full moon View this entry on the original dictionary page scan.
pūrṇenduvadanamfn. having a face like a full moon View this entry on the original dictionary page scan.
puruṣavadbam. manslaughter, murder View this entry on the original dictionary page scan.
puruṣavadbam. slaughter of a husband View this entry on the original dictionary page scan.
pūrvadaihika(also paurva-d-) mfn. done in a former existence View this entry on the original dictionary page scan.
pūrvadakṣiṇamf(ā-)n. south-eastern View this entry on the original dictionary page scan.
pūrvadarśanam. Name of a man View this entry on the original dictionary page scan.
pūrvadattamfn. given before View this entry on the original dictionary page scan.
pūrvadāvikamfn. (fr. -devikā-) View this entry on the original dictionary page scan.
pūrvadeham. a former body View this entry on the original dictionary page scan.
pūrvadeheind. in a formerly birth or existence View this entry on the original dictionary page scan.
pūrvadehika (also paurva-d-) mfn. done in a former existence View this entry on the original dictionary page scan.
pūrvadeśam. the eastern direction View this entry on the original dictionary page scan.
pūrvadeśam. (e-,to the east of[ ablative ] ) View this entry on the original dictionary page scan.
pūrvadeśam. the eastern country View this entry on the original dictionary page scan.
pūrvadevam. a primaeval deity (applied also to the pitṛ-s equals -devatā- ) View this entry on the original dictionary page scan.
pūrvadevam. an asura- or demon (offspring of kaśyapa-, the parent of both gods and demons) View this entry on the original dictionary page scan.
pūrvadevikāf. Name of a village in the eastern part of India View this entry on the original dictionary page scan.
pūrvadhyānan. the first (stage of) contemplation, View this entry on the original dictionary page scan.
pūrvadigīśam. "regent of the eastern quarter"Name of indra- View this entry on the original dictionary page scan.
pūrvadikpati m. "regent of the eastern quarter"Name of indra- View this entry on the original dictionary page scan.
pūrvadīkṣāf. the former consecration View this entry on the original dictionary page scan.
pūrvadīkṣinmfn. taking the formerly consecration View this entry on the original dictionary page scan.
pūrvadinan. the earlier part of the day, forenoon View this entry on the original dictionary page scan.
pūrvadiśf. the eastern region, east quarter View this entry on the original dictionary page scan.
pūrvadiṣṭamfn. determined by former actions View this entry on the original dictionary page scan.
pūrvadiṣṭan. the award of destiny View this entry on the original dictionary page scan.
pūrvadiśyamfn. situated towards the east, hearing east View this entry on the original dictionary page scan.
pūrvadiśyamfn. eastern View this entry on the original dictionary page scan.
pūrvadṛṣṭamfn. seen before View this entry on the original dictionary page scan.
pūrvadṛṣṭamfn. appeared in former times, primaeval View this entry on the original dictionary page scan.
pūrvadṛṣṭamfn. declared by the ancients View this entry on the original dictionary page scan.
pūrvadṛṣṭif. a former view or sight View this entry on the original dictionary page scan.
pūrvadugdhamfn. sucked out or plundered before View this entry on the original dictionary page scan.
pūrvaduṣkṛtabhogam. the pain or penalty consequent on sins committed in a former birth View this entry on the original dictionary page scan.
pūrvadvāramfn. favourable in the eastern region View this entry on the original dictionary page scan.
pūrvadvārikamfn. favourable to an expedition towards the east View this entry on the original dictionary page scan.
pūrvaśaivadīkṣāvidhimn. Name of work View this entry on the original dictionary page scan.
pūrvāvadhīritamfn. formerly disdained View this entry on the original dictionary page scan.
putravadhūf. a son's wife, daughter-in-law View this entry on the original dictionary page scan.
rāghavadevam. Name of various authors View this entry on the original dictionary page scan.
rājavadanam. Name of a man View this entry on the original dictionary page scan.
rājavadham. a kind's weapon View this entry on the original dictionary page scan.
rājendradaśāvadhānam. (with bhaṭṭācārya-) Name of an author View this entry on the original dictionary page scan.
rāmāyaṇatattvadarpaṇam. Name of work View this entry on the original dictionary page scan.
rāvaṇavadham. "killing of rāvaṇa-", original Name of the bhaṭṭi-kāvya-. View this entry on the original dictionary page scan.
ruciravadanamfn. sweet-faced View this entry on the original dictionary page scan.
rucivadhūgalaratnamālāf. Name of work View this entry on the original dictionary page scan.
ruddhavadanamfn. having the mouth filled full (with food) View this entry on the original dictionary page scan.
rudravatvadgaṇamfn. (rudr/a--) surrounded by the rudra- troop (said of soma-) View this entry on the original dictionary page scan.
saccidānandānubhavadīpikāf. Name of work View this entry on the original dictionary page scan.
sadaṃśavadanam. "having a mouth with a sharp beak", a heron View this entry on the original dictionary page scan.
ṣaḍvadanam. Name of skanda- View this entry on the original dictionary page scan.
sahasravadanamfn. idem or 'mfn. containing the word sahasra- ' View this entry on the original dictionary page scan.
sahasravadanam. Name of viṣṇu- View this entry on the original dictionary page scan.
sāhavadīna m. Name (also title or epithet) of a Sultan, View this entry on the original dictionary page scan.
śaivadarśanan. the śaiva- philosophy View this entry on the original dictionary page scan.
śaivadarśanan. Name of the 7th chapter of the sarva-darśana-saṃgraha-. View this entry on the original dictionary page scan.
śaivadharmamaṇḍanan. Name of work on dharma-. View this entry on the original dictionary page scan.
śaivanavadaśaprakaraṇan. Name of work View this entry on the original dictionary page scan.
śālavadanam. Name of an asura- View this entry on the original dictionary page scan.
salvadeśam. Name of a country View this entry on the original dictionary page scan.
samabhivadCaus. -vādayati-, to address or salute respectfully View this entry on the original dictionary page scan.
samabhivadh(defective;See vadh-), to strike or hit at any one (accusative) View this entry on the original dictionary page scan.
samāsvadCaus. -svādayati-, to taste, enjoy View this entry on the original dictionary page scan.
samāvadin compound for prec. View this entry on the original dictionary page scan.
samāvadP. -vadati-, to speak with certainty, state, declare View this entry on the original dictionary page scan.
samāvadbhājmfn. obtaining an equal share View this entry on the original dictionary page scan.
samavadhāP. A1. -dadhāti-, -dhatte-, to lay or put together View this entry on the original dictionary page scan.
samavadhānan. the being brought together, meeting View this entry on the original dictionary page scan.
samavadhānan. great attention View this entry on the original dictionary page scan.
samavadhānan. preparation View this entry on the original dictionary page scan.
samavadhīrayaNom. P. yati-, to disregard, pay no heed to View this entry on the original dictionary page scan.
samāvadindriyamfn. = View this entry on the original dictionary page scan.
samavadiśP. -diśati-, to point or refer to, explain with reference to anything View this entry on the original dictionary page scan.
samavado(or3. dā-) P. -dāti-, or -dyati- (3. plural perfect tense A1. -dadire-), to divide and put together piece by piece View this entry on the original dictionary page scan.
samavadruP. -dravati-, to run away together View this entry on the original dictionary page scan.
samāvadvīrya View this entry on the original dictionary page scan.
samāvadvīrya(sam/āvad--) mfn. equally strong View this entry on the original dictionary page scan.
śambarāsuravadhopākhyānan. story of the killing of śambara- (told in ). View this entry on the original dictionary page scan.
śāmbhavadevam. Name of a poet View this entry on the original dictionary page scan.
śāmbhavadīpikāf. Name of a tantra-. View this entry on the original dictionary page scan.
saṃhṛṣṭavadanamfn. one whose face is beaming with joy View this entry on the original dictionary page scan.
sāṃkhyayogavadinm. an adherent of the theistical sāṃkhya-yoga- View this entry on the original dictionary page scan.
sampravadP. A1. -vadati-, te- (Ved. infinitive mood -vaditos-), to pronounce aloud ; (P.) to utter cries together, sing together ; (A1.) to talk or converse together ; Causal vādayati- See below. View this entry on the original dictionary page scan.
sampravadanan. talking together, conversation View this entry on the original dictionary page scan.
saṃsaktavadanāśvāsamfn. having the breath adhering to the mouth, with suppressed breath View this entry on the original dictionary page scan.
saṃśaptakavadhaparvann. Name of the section of the describing the above. View this entry on the original dictionary page scan.
saṃsvad(only infinitive mood -s/ude-), to taste, enjoy View this entry on the original dictionary page scan.
saṃvadP. A1. -vadati-, te- (ind.p. sam-udya- q.v), (A1.) to speak together or at the same time ; (P.; A1.only mc.) to converse with (instrumental case) or about (locative case) ; (P.) to sound together or in concord (said of musical instruments) , to agree, accord, consent ; to coincide, fit together (so as to give one sense) ; to speak, speak to, address (accusative) ; to designate, call, name (two accusative) : Causal -vādayati-, te- (ind.p. -vādya- q.v), to cause to converse with (instrumental case) or about (locative case) ; to invite or call upon to speak, , (varia lectio) ; to cause to sound, play (a musical instrument) View this entry on the original dictionary page scan.
śaṃvadam. View this entry on the original dictionary page scan.
saṃvadanan. the act of speaking together, conversation View this entry on the original dictionary page scan.
saṃvadanan. a message View this entry on the original dictionary page scan.
saṃvadanan. consideration, examination View this entry on the original dictionary page scan.
saṃvadanan. (also , f(ā-).) subduing by charms or by magic (= or wrong reading for saṃ-vanana- q.v) View this entry on the original dictionary page scan.
saṃvadanan. a charm, amulet View this entry on the original dictionary page scan.
saṃvaditamfn. (fr. idem or 'n. obtaining the victory in disputes, ') caused to speak with etc. View this entry on the original dictionary page scan.
saṃvaditamfn. agreed upon View this entry on the original dictionary page scan.
saṃvaditavyamfn. to be talked over or agreed upon View this entry on the original dictionary page scan.
saṃvaditavyamfn. to be spoken to or addressed. View this entry on the original dictionary page scan.
saṃvatsarasvadita(r/a--) mfn. well seasoned or prepared for a year View this entry on the original dictionary page scan.
saṃvāvadūkamfn. agreeing, consenting View this entry on the original dictionary page scan.
sāntvadamfn. giving comfort or peace to (genitive case) View this entry on the original dictionary page scan.
saptakumārikavadānan. the legend of the 7 maids View this entry on the original dictionary page scan.
saptavadhrimfn. (t/a--) fettered by 7 thongs (applied to the soul) View this entry on the original dictionary page scan.
saptavadhrim. Name of an ātreya- (protected by the aśvin-s and author of the hymns ) View this entry on the original dictionary page scan.
śaradvadhūf. autumn compared to a women View this entry on the original dictionary page scan.
sārāsvadinīf. Name of a vedānta- work View this entry on the original dictionary page scan.
saridvadhūf. a woman compared to a river View this entry on the original dictionary page scan.
sarvadamf(ā-)n. all-bestowing View this entry on the original dictionary page scan.
sarvadam. Name of śiva- View this entry on the original dictionary page scan.
sarvadāSee sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
sarvadāind. always, at all times (often joined with sarvatra-and sarvathā-;with na-,"never") View this entry on the original dictionary page scan.
sarvadāham. complete combustion View this entry on the original dictionary page scan.
sarvadaivasattvan. being at all times View this entry on the original dictionary page scan.
sarvadaivatyamfn. representing all the gods, View this entry on the original dictionary page scan.
sarvadaivatyamfn. equals -sārnad- View this entry on the original dictionary page scan.
sarvadamanamfn. all-subduing or all-taming View this entry on the original dictionary page scan.
sarvadamanam. Name of bharata- (son of śakuntalā-) View this entry on the original dictionary page scan.
sarvadamanam. of an asura- View this entry on the original dictionary page scan.
sarvadānan. the gift of everything, gift of one's all View this entry on the original dictionary page scan.
sarvadānādhikamfn. better than every gift View this entry on the original dictionary page scan.
sarvadānavidhim. Name of work View this entry on the original dictionary page scan.
sarvadaṇḍadharamfn. punishing every one (śiva-) View this entry on the original dictionary page scan.
sarvadarājam. Name of a king View this entry on the original dictionary page scan.
sarvadarśanamfn. all-viewing View this entry on the original dictionary page scan.
sarvadarśanasaṃgraham. "compendium of all the darśana-s", Name of a treatise on the various systems of philosophy (not including the vedānta-) by mādhavācārya- or his brother sāyaṇa- View this entry on the original dictionary page scan.
sarvadarśanaśiromaṇim. Name of work View this entry on the original dictionary page scan.
sarvadarśinmfn. all-seeing View this entry on the original dictionary page scan.
sarvadarśinm. a buddha- View this entry on the original dictionary page scan.
sarvadarśinm. an arhat- (with jaina-s) View this entry on the original dictionary page scan.
sarvadāsam. Name of a, poet View this entry on the original dictionary page scan.
sarvadātṛmfn. all-giver ( sarvadātṛtva -tva- n.) View this entry on the original dictionary page scan.
sarvadātṛtvan. sarvadātṛ
śarvadattam. "given by śarva-", Name of a teacher View this entry on the original dictionary page scan.
sarvadeśavṛttāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
sarvadeśīyamfn. coming from or existing or found in every country on View this entry on the original dictionary page scan.
sarvadeśyamfn. being in all places View this entry on the original dictionary page scan.
sarvadevam. plural all the gods View this entry on the original dictionary page scan.
sarvadevahutāśanamfn. eating the sacrifice designed for all gods View this entry on the original dictionary page scan.
sarvadevahutāśanam. Name of agni- View this entry on the original dictionary page scan.
sarvadevamayamf(ī-)n. comprising or representing all gods etc. View this entry on the original dictionary page scan.
sarvadevamayam. Name of śiva- View this entry on the original dictionary page scan.
sarvadevamukham. (?)"mouth of all the gods" , Name of agni-
sarvadevamūrtipratiṣṭhāvidhim. Name of work View this entry on the original dictionary page scan.
sarvadevapratiṣṭhāf. Name of work View this entry on the original dictionary page scan.
sarvadevapratiṣṭhākarmann. Name of work View this entry on the original dictionary page scan.
sarvadevapratiṣṭhākramavidhim. Name of work View this entry on the original dictionary page scan.
sarvadevapratiṣṭhāvidhim. Name of wks. View this entry on the original dictionary page scan.
sarvadevapūjanaprakāram. Name of work View this entry on the original dictionary page scan.
sarvadevapūjanaprayogam. Name of work View this entry on the original dictionary page scan.
sarvadevasādhāraṇanityapūjāvidhim. Name of work View this entry on the original dictionary page scan.
sarvadevasūktan. Name of work View this entry on the original dictionary page scan.
sarvadevasūrim. Name of an author View this entry on the original dictionary page scan.
sarvadevatamfn. relating to all the deities View this entry on the original dictionary page scan.
sarvadevatāmayamf(ī-)n. containing all deities View this entry on the original dictionary page scan.
sarvadevatāpiṣpādipūjanan. Name of work View this entry on the original dictionary page scan.
sarvadevatāpratisthṭhāsārasaṃgraham. Name of work View this entry on the original dictionary page scan.
sarvadevātmakamfn. () having the nature of all gods, containing all gods View this entry on the original dictionary page scan.
sarvadevātmanmfn. () having the nature of all gods, containing all gods View this entry on the original dictionary page scan.
sarvadevatyamfn. sacred to or representing all the gods View this entry on the original dictionary page scan.
sarvadeveśam. lord of all gods (śiva-) View this entry on the original dictionary page scan.
sarvadevīmayīf. containing or representing all goddesses View this entry on the original dictionary page scan.
sarvadhāmfn. all-refreshing, all-pleasing View this entry on the original dictionary page scan.
sarvadhāmfn. all-containing, all-yielding View this entry on the original dictionary page scan.
sarvadhāmann. the, abode or home of all View this entry on the original dictionary page scan.
sarvadhanan. all one's property View this entry on the original dictionary page scan.
sarvadhanan. (in arithmetic) a sum total, sum or total of a series (in progression) View this entry on the original dictionary page scan.
sarvadhaninmfn. possessed of all goods on Va1rtt. 5. View this entry on the original dictionary page scan.
sarvadhanvinm. "best archer", the god of love (wrong reading -dhanvan-). View this entry on the original dictionary page scan.
sarvadharam. Name of a lexicographer View this entry on the original dictionary page scan.
sarvadharan. Name of work View this entry on the original dictionary page scan.
sarvadhārīthe 22nd year of the cycle (according to to some; see prec.) View this entry on the original dictionary page scan.
sarvadhārīf. sarvadhārin
sarvadhārinm. "all-holder", Name of śiva- View this entry on the original dictionary page scan.
sarvadhārinm. of the 22nd year of Jupiter's cycle of 60 years (also sarvadhārī dhārī- f. according to to some) View this entry on the original dictionary page scan.
sarvadharmamayamf(ī-)n. containing all laws View this entry on the original dictionary page scan.
sarvadharmamudram. a particular samādhi- View this entry on the original dictionary page scan.
sarvadharmanm. Name of a king View this entry on the original dictionary page scan.
sarvadharmapadaprabhedam. a particular samādhi- View this entry on the original dictionary page scan.
sarvadharmaprakāśam. Name of work View this entry on the original dictionary page scan.
sarvadharmapraveśamudram. Name of a particular samādhi- View this entry on the original dictionary page scan.
sarvadharmapraveśanan. Name of a particular samādhi- View this entry on the original dictionary page scan.
sarvadharmaramatāf. Name of a samādhi- View this entry on the original dictionary page scan.
sarvadharmasamatājñānamudrāf. a particular position of the fingers View this entry on the original dictionary page scan.
sarvadharmasamavaśaraṇasāgaramudrāf. Name of a samādhi- View this entry on the original dictionary page scan.
sarvadharmasamavasaraṇasāgaramudram. Name of a samādhi- View this entry on the original dictionary page scan.
sarvadharmātikramaṇam. Name of a samādhi- View this entry on the original dictionary page scan.
sarvadharmavidmfn. knowing all laws View this entry on the original dictionary page scan.
sarvadharmodgatam. Name of a samādhi- View this entry on the original dictionary page scan.
sarvadharmopravṛttinirdeśam. Name of work View this entry on the original dictionary page scan.
sarvadharmottaraghoṣam. Name of a bodhisattva- View this entry on the original dictionary page scan.
sārvadhātukamfn. (fr. sarva-dhātu-) applicable to the whole of a radical term or to the complete form of the verbal base (after the conjugational characteristics or vikaraṇa-s are affixed in the four conjectural or special tenses;in veda- often confounded with the ārdhadhātuka-s q.v) View this entry on the original dictionary page scan.
sārvadhātukan. Name of the verbal terminations of the four conjectural tenses (proper , imperfect tense Potential,and imperative), and of all the root affixes (such as śānac-and śatri-) which have an indicatory J View this entry on the original dictionary page scan.
sarvadhurāvahamfn. bearing all burdens mfn. View this entry on the original dictionary page scan.
sarvadhurāvaham. equals next m. View this entry on the original dictionary page scan.
sarvadhurīṇamfn. fit for any kind of carriage or draught View this entry on the original dictionary page scan.
sarvadhurīṇam. a draught ox or other animal View this entry on the original dictionary page scan.
sarvadigvijayam. conquest of all regions, universal conquest View this entry on the original dictionary page scan.
sarvadiṅmukhamind. towards all regions View this entry on the original dictionary page scan.
sarvadraṣṭṛmfn. all-viewer, all-seeing View this entry on the original dictionary page scan.
sarvadravyan. plural all things View this entry on the original dictionary page scan.
sarvadṛśmfn. all-seeing View this entry on the original dictionary page scan.
sarvadṛśf. plural all eyes id est all organs of senses View this entry on the original dictionary page scan.
sarvadryañcmfn. (See 2. añc-) turned towards all View this entry on the original dictionary page scan.
sarvadryañcmfn. honouring all View this entry on the original dictionary page scan.
sarvadukhakṣayam. destruction of all pain, final emancipation from all existence View this entry on the original dictionary page scan.
sarvaduṣṭāntakṛtmfn. destroying all the wicked View this entry on the original dictionary page scan.
sarvadvārikamfn. favourable to a warlike expedition towards all regions, View this entry on the original dictionary page scan.
sarvānavadyakāriṇīf. Name of work View this entry on the original dictionary page scan.
sarvānavadyāṅgamf(ī-)n. having an entirely faultless body View this entry on the original dictionary page scan.
sarvasvadakṣiṇamfn. (a sacrifice) at which the whole property is given away View this entry on the original dictionary page scan.
sarvasvadaṇḍamfn. fined or mulcted of all possessions View this entry on the original dictionary page scan.
sarvasvadaṇḍan. confiscation of entire property View this entry on the original dictionary page scan.
sarvātmatvadarśanan. sarvātmatva
śaśāṅkavadanāf. a moon-faced woman View this entry on the original dictionary page scan.
śaśivadanāf. equals -mukhī- View this entry on the original dictionary page scan.
śaśivadanāf. two kinds of metre View this entry on the original dictionary page scan.
sāsthivadham. the killing of any animal having bones View this entry on the original dictionary page scan.
śastravadham. killing with a weapon (in a-ś-,"killing without a weapon") View this entry on the original dictionary page scan.
śaśvadhāind. again and again, ever and ever again View this entry on the original dictionary page scan.
sasvadham. plural "having the svadhā- (q.v) ", a particular class of deceased ancestors View this entry on the original dictionary page scan.
śataparvadhṛkm. "bearer of the thunderbolt", Name of indra- View this entry on the original dictionary page scan.
śatavadha(śat/a--) mf(ā-)n. causing a hundred deaths View this entry on the original dictionary page scan.
śatāvadhānam. "a man with such a good memory that he can attend to a hundred things at once"(also nin-), Name of rāghavendra- View this entry on the original dictionary page scan.
śaṭhavairivaibhavadīpikāf. Name of work View this entry on the original dictionary page scan.
sattvadhāmann. "abode of the quality sattva-"Name of viṣṇu- View this entry on the original dictionary page scan.
sattvadhātum. the animal sphere, animated nature View this entry on the original dictionary page scan.
satyavadanan. the speaking of truth View this entry on the original dictionary page scan.
satyavadanaśīlamfn. habitually truthful View this entry on the original dictionary page scan.
satyavadyamfn. speaking truly View this entry on the original dictionary page scan.
satyavadyan. truth View this entry on the original dictionary page scan.
śauvadaṃṣṭra varia lectio for śauvādaṃṣṭra-. View this entry on the original dictionary page scan.
śavadāham. idem or 'f. cremation of a corpse ' View this entry on the original dictionary page scan.
śavadāhaka m. a corpses-burner View this entry on the original dictionary page scan.
śavadāhinm. a corpses-burner View this entry on the original dictionary page scan.
śavadahyāf. cremation of a corpse View this entry on the original dictionary page scan.
sāvadānamind. (see 2. avadāna-) with interruption (?) View this entry on the original dictionary page scan.
śavadhānam. plural Name of a people (see śara-dh-). View this entry on the original dictionary page scan.
sāvadhānamf(ā-)n. having attention, attentive, heedful, careful View this entry on the original dictionary page scan.
sāvadhānamf(ā-)n. intent upon doing anything (infinitive mood) View this entry on the original dictionary page scan.
sāvadhānamind. attentively, cautiously View this entry on the original dictionary page scan.
sāvadhānasāhityan. Name of work View this entry on the original dictionary page scan.
sāvadhānatāf. attention, carefulness View this entry on the original dictionary page scan.
sāvadhānayaNom. P. yati-, to make careful, put on one's guard View this entry on the original dictionary page scan.
sāvadhānīin compound for sāvadhāna-. View this entry on the original dictionary page scan.
sāvadhānībhūP. -bhavati-, to be attentive or careful View this entry on the original dictionary page scan.
sāvadhānīkṛP. -karoti-, to make attentive or careful, caution View this entry on the original dictionary page scan.
sāvadhānīkṛtamfn. cautioned, apprized, made aware View this entry on the original dictionary page scan.
śavadharamfn. carrying a corpses View this entry on the original dictionary page scan.
sāvadhāraṇamfn. having a limitation or restriction, limited, restricted View this entry on the original dictionary page scan.
sāvadhimfn. having a boundary or limit, defined, circumscribed View this entry on the original dictionary page scan.
savadhūkam. along with a wife, a man and his wife View this entry on the original dictionary page scan.
sāvadyamfn. liable to blame or censure, objectionable View this entry on the original dictionary page scan.
sāvadyan. anything blamable or objectionable View this entry on the original dictionary page scan.
sāvadyan. (scilicet aiśvarya-) one of the three kinds of power attainable by an ascetic (the other two being nir-avadya-and sūkṣma-) View this entry on the original dictionary page scan.
savivadhamfn. holding the equipoise ( savivadhatva -tv/a- n.) View this entry on the original dictionary page scan.
savīvadhamfn. ( savīvadhatā -tā- f. savīvadhatva -tva- n.) equals -viv- View this entry on the original dictionary page scan.
savīvadhatāf. savīvadha
savivadhatvan. savivadha
savīvadhatvan. savīvadha
śevadhim. ( also n.) "treasure-receptacle", wealth, treasure, jewel etc. View this entry on the original dictionary page scan.
śevadhim. treasury, an inexhaustible quantity (of good or evil) View this entry on the original dictionary page scan.
śevadhim. one of the nine treasures of kubera- View this entry on the original dictionary page scan.
sevadhi wrong reading for śeva-dhi-. View this entry on the original dictionary page scan.
śevadhipāmfn. guarding treasure View this entry on the original dictionary page scan.
siddhāntatattvadīpam. Name of work View this entry on the original dictionary page scan.
śiśupālavadham. "slaying of śiśu-", Name of a poem by māgha- (q.v) on the above subject View this entry on the original dictionary page scan.
śiśupālavadhaparvann. Name of a chapter of the mahā-bhārata- on the same subject View this entry on the original dictionary page scan.
śivadaivan. Name of the lunar mansion ārdrā- (presided over by śiva-) View this entry on the original dictionary page scan.
śivadaṇḍaka(prob.) m. (?) Name of an author View this entry on the original dictionary page scan.
śivadārun. the tree Pinus Deodora View this entry on the original dictionary page scan.
śivadāsam. " śaṃkara-'s servant", Name of various writers and other men (especially of the author of the kathārṇava-, the vetāla-pañcaviṃśati-, and the śāli-vāhana-caritra-) View this entry on the original dictionary page scan.
śivadāsam. (with cakravartin-) Name of the author of a commentator or commentary on the uṇādi-sūtra- of the kātantra- grammar View this entry on the original dictionary page scan.
śivadāsadevam. Name of a poet View this entry on the original dictionary page scan.
śivadaśakan. Name of two works. View this entry on the original dictionary page scan.
śivadāsasenam. Name of the author of the tattva-candrikā- View this entry on the original dictionary page scan.
śivadattam. "given by or presented to śaṃkara-", (with śarman-, miśra-and sūri-) Name of three authors View this entry on the original dictionary page scan.
śivadattam. of various other men View this entry on the original dictionary page scan.
śivadattan. the discus of viṣṇu- View this entry on the original dictionary page scan.
śivadattapuran. Name of a town in the east View this entry on the original dictionary page scan.
śivadayālum. Name of the author of a commentator or commentary on the bhagavad-gītā-. View this entry on the original dictionary page scan.
śivadayāsahasran. Name of a stotra-. View this entry on the original dictionary page scan.
śivadāyinmfn. varia lectio for -tāti- View this entry on the original dictionary page scan.
śivadevam. Name of two kings and of a grammarian View this entry on the original dictionary page scan.
śivadevan. = (or varia lectio for) next View this entry on the original dictionary page scan.
śivadhanurvedam. Name of work attributed to vyāsa- View this entry on the original dictionary page scan.
śivadhāram. Name of a tīrtha- View this entry on the original dictionary page scan.
śivadhāriṇī varia lectio for -kāriṇī-. View this entry on the original dictionary page scan.
śivadharman. Name of a chapter of the nandikeśvara-saṃhitā- View this entry on the original dictionary page scan.
śivadharmopapurāṇan. Name of an upa-purāṇa- View this entry on the original dictionary page scan.
śivadharmottaran. Name of a sequel of the prec. work View this entry on the original dictionary page scan.
śivadhātum. " śiva-'s essence", quicksilver View this entry on the original dictionary page scan.
śivadhātum. śiva-'s mineral, milk-stone, opal or chalcedony View this entry on the original dictionary page scan.
śivadhyānapaddhatif. Name of work View this entry on the original dictionary page scan.
śivadīkṣāf. Name of work View this entry on the original dictionary page scan.
śivadīkṣāṭikāf. Name of a commentator or commentary on it. View this entry on the original dictionary page scan.
śivadīnam. Name of a lexicographer View this entry on the original dictionary page scan.
śivadīnadāsam. Name of an astronomer View this entry on the original dictionary page scan.
śivadiśf. " śiva-'s quarter", the north-east View this entry on the original dictionary page scan.
śivadṛṣṭif. Name of work (containing the śaiva- system, by somānanda-nātha-). View this entry on the original dictionary page scan.
śivadrumam. Aegle Marmelos View this entry on the original dictionary page scan.
śivadūtīf. " śiva-'s messenger", Name of a form of durgā- View this entry on the original dictionary page scan.
śivadūtīf. of a yoginī- View this entry on the original dictionary page scan.
śivadūtikāf. Name of one of the mātṛ-s attending on śiva- View this entry on the original dictionary page scan.
śivadūtītantran. Name of a tantra-. View this entry on the original dictionary page scan.
śivadviṣṭāf. Pandanus Odoratissimus
śivadyumaṇidīpikāf. Name of work (also called dina-karoddyota-). View this entry on the original dictionary page scan.
śivapañcavadanastotran. Name of work View this entry on the original dictionary page scan.
smaravadhūyaNom. P. yati-, to resemble kāma-'s wife View this entry on the original dictionary page scan.
sravadin compound for sravat-. View this entry on the original dictionary page scan.
sravadgarbhāf. a woman (or any female animal, as a cow) that miscarries View this entry on the original dictionary page scan.
sravadraṅgam. "stirring town", a fair, market, bazaar View this entry on the original dictionary page scan.
sṛgālavadanam. "jackal-faced", Name of an asura- View this entry on the original dictionary page scan.
śrīraṅgadevadevālayapradakṣiṇan. Name of work View this entry on the original dictionary page scan.
śrīvadam. a kind of bird View this entry on the original dictionary page scan.
śṛtāvadānan. a wooden implement for distributing the puroḍāśa- (q.v) View this entry on the original dictionary page scan.
śrutavadanamfn. one whose speech is (readily) heard View this entry on the original dictionary page scan.
sruvadaṇḍam. the handle of the ladle sruva- View this entry on the original dictionary page scan.
sruvadrumam. equals -taru- View this entry on the original dictionary page scan.
stavadaṇḍakamn. Name of work View this entry on the original dictionary page scan.
stavadhyaiSee above under root. View this entry on the original dictionary page scan.
sthānivadbhāvam. (equals -vat-tva-) View this entry on the original dictionary page scan.
strīvadham. the slaying of a woman, View this entry on the original dictionary page scan.
sūcivadanam. (perhaps wrong reading for -radana-) "needle-faced", the mungoose View this entry on the original dictionary page scan.
sūcivadanam. a musquito View this entry on the original dictionary page scan.
śuddhatattvadāsavijñaptif. Name of work View this entry on the original dictionary page scan.
sudhāvadātamfn. (dhāv-) equals -dhavala- View this entry on the original dictionary page scan.
sudhāvadātamfn. Name of a mountain View this entry on the original dictionary page scan.
ṣuduvadīnam. Name (also title or epithet) of a Sultan, View this entry on the original dictionary page scan.
sugatāvadānan. Name of a Buddhist sūtra- work View this entry on the original dictionary page scan.
suhṛdvadham. the killing of a friend View this entry on the original dictionary page scan.
sukhāvaddevam. (with śākta-s) Name of a particular class of authors of mystical prayers View this entry on the original dictionary page scan.
sukhāvadvyūham. Name of a Buddhist work View this entry on the original dictionary page scan.
śuktivadhūf. mother of pearl (or the pearl oyster which produces the pearl) View this entry on the original dictionary page scan.
śumbhavadham. "killing of śumbha-", Name of a chapter of the devīmāhātmya-. View this entry on the original dictionary page scan.
sundāsuravadhūf. the wife of the asura- sunda- (called tāḍakā-) View this entry on the original dictionary page scan.
suparyavadātamfn. very clean View this entry on the original dictionary page scan.
suprabhavadeva wrong reading for -prabhad-, Sis. View this entry on the original dictionary page scan.
suravadhūf. idem or 'f. Name of durgā- ' View this entry on the original dictionary page scan.
susvadham. plural Name of a particular class of deceased ancestors View this entry on the original dictionary page scan.
susvadhāf. welfare, prosperity View this entry on the original dictionary page scan.
sutasomāvadānan. equals ma-jātaka-. View this entry on the original dictionary page scan.
suvadanamf(ā-)n. having a handsome or beautiful face View this entry on the original dictionary page scan.
suvadanam. a kind of plant (equals sumukha-) View this entry on the original dictionary page scan.
suvadanāf. a beautiful woman View this entry on the original dictionary page scan.
suvadanam. a kind of metre View this entry on the original dictionary page scan.
suvadanam. Name of a woman View this entry on the original dictionary page scan.
suvibhaktānavadyāngīf. (a woman) having symmetrical and faultless limbs View this entry on the original dictionary page scan.
svabhāvadaurjanyan. natural or innate wickedness View this entry on the original dictionary page scan.
svabhāvadveṣam. natural hatred View this entry on the original dictionary page scan.
svad or svād- (prob. fr. 5. su- ad-) cl.1 A1. () sv/adate- (Vedic or Veda also P. sv/adati-; perfect tense sasvade- ; sasvāde- grammar; future svāditā-, svādiṣyate- ; Vedic or Veda infinitive mood -s/ude-; ind.p. -svādya- ), to taste well, be sweet or pleasant to (dative case or genitive case) etc. ; to taste with pleasure, relish, enjoy, like (accusative), delight in (locative case) ; (P.) to make palatable, season ; to make sweet or pleasant or agreeable ; to be pleasant or wholesome ; P. A1. svādati-, te- (confer, compare ), to taste, relish, enjoy (generally varia lectio khād- q.v) : Causal svad/ayati-, te- (Aorist asiṣvadat-), to make savoury or palatable, sweeten, season, prepare, cook ; to propitiate, conciliate ; svādayati- (confer, compare ), to eat, relish, taste, enjoy : Desiderative of Causal sisvādayiṣati- grammar : Desiderative sisvādiṣate- : Intensive sāsvādyate-, sāsvātti- [ confer, compare Greek ; Latin suadeo,and undersvAdu.]
śvadaṃṣṭrāf. a dog's tooth View this entry on the original dictionary page scan.
śvadaṃṣṭrāf. Asteracantha Longifolia View this entry on the original dictionary page scan.
śvadaṃṣṭrāf. equals go-kṣura- View this entry on the original dictionary page scan.
śvadaṃṣṭrakam. Tribulus Lanuginosus View this entry on the original dictionary page scan.
śvadaṃṣṭrinm. a kind of animal View this entry on the original dictionary page scan.
svadānan. the giving of one's own property View this entry on the original dictionary page scan.
svadanan. the act of tasting, licking, eating, enjoying View this entry on the original dictionary page scan.
svadāna sva-dāra- etc. See . View this entry on the original dictionary page scan.
svadāram. one's own wife View this entry on the original dictionary page scan.
svadāragāminmfn. cohabiting with one's own wife View this entry on the original dictionary page scan.
svadāraniratamfn. attached to one's own wife, uxorious View this entry on the original dictionary page scan.
svadāvanmfn. (formed analogously to svadhāvan-;prob.)"having a good taste"or"enjoying dainty food" View this entry on the original dictionary page scan.
śvadayitan. "dear to dog", a bone View this entry on the original dictionary page scan.
svadayitṛmfn. one who seasons or makes palatable View this entry on the original dictionary page scan.
svadehadānan. the gift of one's own body View this entry on the original dictionary page scan.
svadeśam. one's own place or country or home etc. View this entry on the original dictionary page scan.
svadeśam. plural the inhabitants of one's own country, one's own subjects View this entry on the original dictionary page scan.
svadeśabandhum. (equals -ja-) View this entry on the original dictionary page scan.
svadeśajam. "born in one's own country", a countryman View this entry on the original dictionary page scan.
svadeśamadhyaparidhim. circumference of the terrestrial equator View this entry on the original dictionary page scan.
svadeśaparidhim. circumference of a circle of longitude in any place that has latitude View this entry on the original dictionary page scan.
svadeśasmārinmfn. yearning for one's own country, home-sick View this entry on the original dictionary page scan.
svadhāSee , and sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
svadhāf. (for svadh/ā-See p.1280) self-position, self-power, inherent power (according to to some, Name of Nature or the material Universe; sva-dh/ayā-"by self-power") View this entry on the original dictionary page scan.
svadhāf. own state or condition or nature, habitual state, custom, rule, law View this entry on the original dictionary page scan.
svadhāf. ease, comfort, pleasure (/anu svadh/ām-, svadh/ām /anu-or svadh/ā /anu-, svadh/ayā-,or svadh/ābhiḥ-,"according to one's habit or pleasure, spontaneously, willingly, easily, freely, undisturbedly, wantonly, sportively") View this entry on the original dictionary page scan.
svadhāf. own place, home (svadh/e- dual number"the two places or homes", heaven and earth ) View this entry on the original dictionary page scan.
svadhāf. "own portion or share", the sacrificial offering due to each god, (especially) the food or libation, or refreshing drink (see 2. su-dhā-) offered to the pitṛ-s or spirits of deceased ancestors (consisting of clarified butter etc. and often only a remainder of the havis-;also applied to other oblations or libations, and personified as a daughter of dakṣa- and wife of the pitṛ-s or of aṅgiras- or of a rudra- or of agni-) etc. View this entry on the original dictionary page scan.
svadhāind. (with dative case or genitive case) the exclamation or benediction used on presenting (or as a substitute for) the above oblation or libation to the gods or departed ancestors (according to to the highest form of benediction at a śrāddha-;with kṛ-,"to pronounce the exclamation or benediction sva-dhā-"; svadhāstu-,"let there be a blessing on it"[ see ]) View this entry on the original dictionary page scan.
svadhāf. (for sva-dhā-See) an axe, knife View this entry on the original dictionary page scan.
svadhābhājinm. plural "Sva-dha1-eating", the pitṛ-s View this entry on the original dictionary page scan.
svadhābhujm. "id.", a god View this entry on the original dictionary page scan.
svadhābhujm. plural equals prec. View this entry on the original dictionary page scan.
svadhādhipa(dhādh-) m. "lord of the Sva-dha1", Name of agni- View this entry on the original dictionary page scan.
svadhākaramfn. offering libations and oblations to deceased ancestors or deified progenitors View this entry on the original dictionary page scan.
svadhākaramfn. equals next View this entry on the original dictionary page scan.
svadhākāram. pronouncing the benediction svadhā- or the exclamation itself View this entry on the original dictionary page scan.
svadhāmahe(formed like yajāmahe-) a sacrificial exclamation or benediction View this entry on the original dictionary page scan.
svadhāmanm. Name of a son of satya-sahas- and sūnṛtā- View this entry on the original dictionary page scan.
svadhāmanm. plural Name of a class of gods under the 3rd manu- View this entry on the original dictionary page scan.
svadhāmayamf(ī-)n. "full of Sva-dha1", the female breast View this entry on the original dictionary page scan.
svadhāmṛtamaya(dhāmṛ-) mfn. consisting of sva-dhā- and nectar (said of a śrāddha-) View this entry on the original dictionary page scan.
svadhāninayanan. performance of a śrāddha- rite with sva-dhā- View this entry on the original dictionary page scan.
svadhāninayanīyamfn. relating to it View this entry on the original dictionary page scan.
svadhāpatim. lord of the sva-dhā- (indra-) View this entry on the original dictionary page scan.
svadhāprāṇa(dh/ā--) mfn. breathing sva-dhā- View this entry on the original dictionary page scan.
svadhāpriyam. "fond of Sva-dha1", agni- or fire View this entry on the original dictionary page scan.
svadhāpriyam. black sesamum (equals tila-or sesamum offered to the pitṛ-s) View this entry on the original dictionary page scan.
svadharmam. one's own rights (maṃ-labh-,"to get justice") View this entry on the original dictionary page scan.
svadharmam. one's own duty etc. View this entry on the original dictionary page scan.
svadharmam. peculiar property, peculiarity View this entry on the original dictionary page scan.
svadharmaetc. See . View this entry on the original dictionary page scan.
svadharmācaraṇan. the practising one's own duties View this entry on the original dictionary page scan.
svadharmacyutamfn. deprived of one's own rights, fallen from or neglecting one's own duty View this entry on the original dictionary page scan.
svadharmādhvabodham. Name of work View this entry on the original dictionary page scan.
svadharmanmfn. abiding in one's own customs View this entry on the original dictionary page scan.
svadharmānapagamfn. not swerving from one's duties View this entry on the original dictionary page scan.
svadharmārthaviniścayam. the knowing or ascertaining one's own duty and interest
svadharmaskhalanan. falling from or neglect of one's own duty View this entry on the original dictionary page scan.
svadharmasthamfn. abiding in one's own duty View this entry on the original dictionary page scan.
svadharmatyāgam. dereliction or neglect of one's own duty View this entry on the original dictionary page scan.
svadharmatyāgam. abandoning one's own religion, apostasy View this entry on the original dictionary page scan.
svadharmavartinmfn. applying one's self to one's duties ( svadharmavartitva ti-tva- n.) View this entry on the original dictionary page scan.
svadharmavartitvan. svadharmavartin
svadhāśanam. plural " svadhā- eaters", the pitṛ-s View this entry on the original dictionary page scan.
svadhāvanmf(arī-)n. lawful, constant, faithful View this entry on the original dictionary page scan.
svadhāvanmf(arī-)n. containing homes (as heaven and earth) View this entry on the original dictionary page scan.
svadhāvatmfn. (dh/ā--) adhering to custom or law, regular, constant, faithful View this entry on the original dictionary page scan.
svadhāvatmfn. containing oblations or refreshment View this entry on the original dictionary page scan.
svadhāvatmfn. containing the word svadhā- View this entry on the original dictionary page scan.
svadhāvatm. plural a class of pitṛ-s (Bombay edition sudhāvat-). View this entry on the original dictionary page scan.
svadhāvinmfn. containing refreshment View this entry on the original dictionary page scan.
svadhāvinmfn. owning the svadhā- (See svadhāy/in-).
svadhayaNom. P. yati-, to propitiate, conciliate (Scholiast or Commentator) View this entry on the original dictionary page scan.
svadhaya yati- See . View this entry on the original dictionary page scan.
svadhāyinmfn. owning the svadhā- (said of the pitṛ-s; varia lectio svadhāv/in-) View this entry on the original dictionary page scan.
svadhenava(sv/a--) mfn. coming from one's own cows View this entry on the original dictionary page scan.
svadhicaraṇamf(/ā-)n. good to be walked upon View this entry on the original dictionary page scan.
svadhiṣṭhānamfn. having a good standing-place (said of a war-chariot) View this entry on the original dictionary page scan.
svadhiṣṭhitamfn. good to be stood on or lived in (accusative) View this entry on the original dictionary page scan.
svadhiṣṭhitamfn. well-guided (as an elephant) View this entry on the original dictionary page scan.
svadhitamfn. = su-dhita-1, firm, solid View this entry on the original dictionary page scan.
svadhītamfn. well-recited or repeated or studied (as the veda-), well read, well instructed, View this entry on the original dictionary page scan.
svadhītan. anything well repeated or learned View this entry on the original dictionary page scan.
śvadhitisee svadh-, parasmE-pada 1280. View this entry on the original dictionary page scan.
svadhitimf. (also written śv-) an axe etc. (in among the vajra-nāmāni-; dev/ī sv/adhitiḥ-,"heavenly axe", thunderbolt) View this entry on the original dictionary page scan.
svadhitimf. a saw View this entry on the original dictionary page scan.
svadhitimf. (according to some) a large tree with hard wood View this entry on the original dictionary page scan.
svadhītimfn. good repetition or recitation (as of the veda- or other sacred work) View this entry on the original dictionary page scan.
svadhitihetikam. "axe-armed", a soldier armed with an axe View this entry on the original dictionary page scan.
svadhitīvatmfn. furnished with axes or knives (said of the chariot of the marut-s; according to to some,"made of svadhiti- wood"See above ) View this entry on the original dictionary page scan.
svadhṛti(sv/a--) f. standing still of one's self View this entry on the original dictionary page scan.
svadhurmfn. self-dependent, independence (Scholiast or Commentator) View this entry on the original dictionary page scan.
svadhurn. (accusative -dhūr-?) Name of a sāman- View this entry on the original dictionary page scan.
śvadhūrtam. "dog-rogue", a jackal View this entry on the original dictionary page scan.
svadhvaram. n. a good sacrifice View this entry on the original dictionary page scan.
svadhvaramfn. performing a sacrifice well, well adapted to a sacrifice View this entry on the original dictionary page scan.
svadhvaryumfn. having a good adhvaryu- priest View this entry on the original dictionary page scan.
svadhyakṣamf(/ā-)n. good to be inspected View this entry on the original dictionary page scan.
svadhyavasānamf(/ā-)n. good to be striven after View this entry on the original dictionary page scan.
svadiṅmukhamind. towards (its) own place or quarter View this entry on the original dictionary page scan.
svaditamfn. well seasoned or prepared, savoury View this entry on the original dictionary page scan.
svaditan. "may it be well tasted or eaten!"(an exclamation used at a śrāddha- after presenting the oblation of food to the pitṛ-s; see su-śruta-, sva-dhā-) View this entry on the original dictionary page scan.
svadoṣajamf(ā-)n. due to one's own fault View this entry on the original dictionary page scan.
svadṛśmfn. seeing one's self or the soul View this entry on the original dictionary page scan.
svadṛṣṭamfn. self-seen (?) (varia lectio saṃhṛṣṭa-). View this entry on the original dictionary page scan.
śvadṛtim. a dog's bladder View this entry on the original dictionary page scan.
svaduhitṛf. one's own daughter View this entry on the original dictionary page scan.
svapnavāsavadattānāṭakan. Name of work View this entry on the original dictionary page scan.
svarārāvadhānan. Name of work View this entry on the original dictionary page scan.
svargavadhūf. "celestial nymph", an apsaras- View this entry on the original dictionary page scan.
svargivadhū f. a celestial woman, apsaras- View this entry on the original dictionary page scan.
svarvadhūf. equals -yoṣit- View this entry on the original dictionary page scan.
svasvadham. plural Name of a particular class of pitṛ-s View this entry on the original dictionary page scan.
svātmanvadham. suicide View this entry on the original dictionary page scan.
svayamavadīrṇan. a natural fissure on the surface of the earth View this entry on the original dictionary page scan.
svayaṃvaravadhūf. a self-chosen wife View this entry on the original dictionary page scan.
śvetāśvadānavidhim. Name of work View this entry on the original dictionary page scan.
śyāmāvadātamf(ā-)n. dazzling black or blackish white View this entry on the original dictionary page scan.
śyāvada(wrong reading) equals next View this entry on the original dictionary page scan.
śyāvadantamfn. ( ; śyāvadantatā -tā- f. ) having dark or discoloured teeth (according to to some "having a little tooth growing over the two front teeth") . View this entry on the original dictionary page scan.
śyāvadantaka( ), mfn. having dark or discoloured teeth (according to to some "having a little tooth growing over the two front teeth") . View this entry on the original dictionary page scan.
śyāvadantatāf. śyāvadanta
śyāvadatmfn. (śyāv/a-- etc.) having dark or discoloured teeth (according to to some "having a little tooth growing over the two front teeth") . View this entry on the original dictionary page scan.
tadavadhiind. from that time View this entry on the original dictionary page scan.
tadavadhiind. up to that period View this entry on the original dictionary page scan.
tapurvadha(t/ap-) mfn. having burning weapons View this entry on the original dictionary page scan.
tārakavadham. " tāraka--slaughter", Name of View this entry on the original dictionary page scan.
tattvadarśam. (equals -dṛś-) Name of a ṛṣi- under manu- deva-sāvarṇi- View this entry on the original dictionary page scan.
tattvadarśinmfn. equals -dṛś- View this entry on the original dictionary page scan.
tattvadarśinm. Name of one of manu- raivata-'s sons View this entry on the original dictionary page scan.
tattvadarśinm. Name of a Brahman, View this entry on the original dictionary page scan.
tattvadīpanan. " tattva--light", Name of work View this entry on the original dictionary page scan.
tattvadṛśmfn. perceiving truth View this entry on the original dictionary page scan.
tāvadin compound for vat-. View this entry on the original dictionary page scan.
tāvaddhāind. in that number, in such a number View this entry on the original dictionary page scan.
tāvaddvayasamfn. so large, so long Va1rtt. 1. View this entry on the original dictionary page scan.
tāvadguṇamfn. having so many qualities View this entry on the original dictionary page scan.
tāvadguṇitamfn. (in mathematics) squared. View this entry on the original dictionary page scan.
tāvadvarṣamfn. so many years old View this entry on the original dictionary page scan.
tāvadvidhamfn. of such kind, View this entry on the original dictionary page scan.
tāvadvīryavat(t/āv-) mfn. having so great force or efficacy View this entry on the original dictionary page scan.
tāvadvyakta(in algebra) a known number annexed to an unknown quantity. View this entry on the original dictionary page scan.
tridaśavadhūf. "wife of the gods", an apsaras- View this entry on the original dictionary page scan.
tripuravadham. "destruction of tripura-" (rasya v- ), Name of View this entry on the original dictionary page scan.
tūṇavadhmam. a flute-player View this entry on the original dictionary page scan.
turaṃgavadanam. equals -mukha- View this entry on the original dictionary page scan.
tvad equals tvat-. View this entry on the original dictionary page scan.
tvadānīmind. sometimes View this entry on the original dictionary page scan.
tvadanyamfn. other than thee View this entry on the original dictionary page scan.
tvadarthamind. on thy account, about thee. View this entry on the original dictionary page scan.
tvadartheind. on thy account, about thee. View this entry on the original dictionary page scan.
tvadbhayan. dread of thee View this entry on the original dictionary page scan.
tvadbhūto become thou View this entry on the original dictionary page scan.
tvaddevatyamfn. having thee as deity View this entry on the original dictionary page scan.
tvaddhitamfn. suitable (hita-) for thee View this entry on the original dictionary page scan.
tvadgṛhan. thy house. View this entry on the original dictionary page scan.
tvadīyamfn. thy, your, thine, yours View this entry on the original dictionary page scan.
tvadrikind. towards thee View this entry on the original dictionary page scan.
tvadvidhamfn. like thee View this entry on the original dictionary page scan.
tvadvivācana(tv/ad--) mfn. having thee as an umpire View this entry on the original dictionary page scan.
tvadviyogam. separation from thee. View this entry on the original dictionary page scan.
tvadyaNom. yati-, to wish thee ; yate-, to act like thou View this entry on the original dictionary page scan.
tvadyoni(tv/ad--) mfn. proceeding from thee View this entry on the original dictionary page scan.
udakavīvadham. equals udavī- q.v , View this entry on the original dictionary page scan.
udavīvadham. a yoke used in carrying water View this entry on the original dictionary page scan.
uddhavadūta m. Name of two poems. View this entry on the original dictionary page scan.
udvadP. -vadati- (infinitive mood /ud-vaditos- ) to raise one's voice, utter, speak, pronounce : Causal -vādayati-, to cause to proclaim ; to cause to resound View this entry on the original dictionary page scan.
udvadhP. (Aorist subjunctive -vadhīt-) to tear to pieces, lacerate View this entry on the original dictionary page scan.
upāṃśuvadham. a clandestine murder View this entry on the original dictionary page scan.
upapravadP. (imperative 2. sg. -pr/avada-) to join in View this entry on the original dictionary page scan.
upavadP. -vadati-, to speak ill of, decry, abuse, curse ; to speak to, address : A1. -vadate-, to talk over, conciliate ; to flatter ; to cajole, court secretly View this entry on the original dictionary page scan.
upavadhP. (Aorist up/āvadhīt-) to strike at or upon ; to strike dead, kill View this entry on the original dictionary page scan.
upāvadhā View this entry on the original dictionary page scan.
ūrdhvadaṃṣṭrakeśam. "one whose teeth and hair are erect", Name of śiva- View this entry on the original dictionary page scan.
ūrdhvadeham. a body gone above or into heaven, a deceased one (see aurdhvadehika-.) View this entry on the original dictionary page scan.
ūrdhvadevam. Name of viṣṇu- View this entry on the original dictionary page scan.
ūrdhvadiśf. the point of the sky overhead, the region above, zenith View this entry on the original dictionary page scan.
ūrdhvadṛśmfn. looking or seeing upwards View this entry on the original dictionary page scan.
ūrdhvadṛśm. (k-) a crab View this entry on the original dictionary page scan.
ūrdhvadṛṣṭif. a glance or look upwards View this entry on the original dictionary page scan.
ūrdhvadṛṣṭimfn. looking upwards. View this entry on the original dictionary page scan.
ūrdhvadvāran. the gate opening into heaven, View this entry on the original dictionary page scan.
ūvadhyaSee /ūbadhya-. View this entry on the original dictionary page scan.
vāgvadam. (prob.) a kind of bat (varia lectio valgu-da-). View this entry on the original dictionary page scan.
vāgvadvatītīrṭhayātrāprakāśam. Name of work View this entry on the original dictionary page scan.
vahnivadhūf. the wife of agni- (svāhā-) View this entry on the original dictionary page scan.
vaidyajīvadāsam. Name of a poet View this entry on the original dictionary page scan.
vaiśākhavadiind. in the dark half of the month vaiśākha- (in giving dates) . View this entry on the original dictionary page scan.
vaiṣṇavadāsam. Name of an author View this entry on the original dictionary page scan.
vaiṣṇavadharmamīmāṃsāf. Name of work View this entry on the original dictionary page scan.
vaiṣṇavadharmānuṣṭhānapaddhatif. Name of work View this entry on the original dictionary page scan.
vaiṣṇavadharmasuradrumamañjarif. Name of work View this entry on the original dictionary page scan.
vaiṣṇavadhyānaprakāram. Name of work View this entry on the original dictionary page scan.
vaiṣṇavadīkṣāpaddhatif. Name of work View this entry on the original dictionary page scan.
vaiśvadaivatan. equals devata-. View this entry on the original dictionary page scan.
vaiśvadaivika varia lectio for devaka-. View this entry on the original dictionary page scan.
vaiśvadevamf(ī-)n. (fr. viśva-deva-) relating or sacred to all the gods or to the viśve- devāḥ- etc. View this entry on the original dictionary page scan.
vaiśvadevam. a particular graha- or soma--vessel View this entry on the original dictionary page scan.
vaiśvadevam. a particular ekāha- View this entry on the original dictionary page scan.
vaiśvadevam. the 8th day of the 2nd half of the month māgha- View this entry on the original dictionary page scan.
vaiśvadevam. a kind of metre View this entry on the original dictionary page scan.
vaiśvadevan. a particular śastra- View this entry on the original dictionary page scan.
vaiśvadevan. the first parvan- of the cāturmāsya- View this entry on the original dictionary page scan.
vaiśvadevan. (exceptionally m.) Name of a particular religious ceremony which ought to be performed morning and evening and especially before the midday meal (it consists in homage paid to the viśve- devāḥ- followed by the bali-haraṇa-or offering of small portions of cooked food to all the gods who give the food and especially to the god of fire who cooks the food and bears the offering to heaven) etc. (see ) View this entry on the original dictionary page scan.
vaiśvadevan. Name of particular verses or formulas View this entry on the original dictionary page scan.
vaiśvadevan. of various sāman-s View this entry on the original dictionary page scan.
vaiśvadevan. the nakṣatra- uttarāṣāḍhā- (see under vaiśva-) View this entry on the original dictionary page scan.
vaiśvadevabalikarmann. dual number Name of the above two ceremonies View this entry on the original dictionary page scan.
vaiśvadevādimantravyākhyāf. Name of work View this entry on the original dictionary page scan.
vaiśvadevāgnim. the fire at the vaiśvadeva--deities ceremony View this entry on the original dictionary page scan.
vaiśvadevāgnimārutamfn. consecrated to the viśve- devāḥ- and to agni- and to the marut-s View this entry on the original dictionary page scan.
vaiśvadevahomam. the offering made to all the gods and to Fire at the vaiśvadeva- ceremony View this entry on the original dictionary page scan.
vaiśvadevakan. (fr. viśva-deva-) gaRa manojñādi-. View this entry on the original dictionary page scan.
vaiśvadevakarmann. the above homage to the deities collectively View this entry on the original dictionary page scan.
vaiśvadevakhaṇḍanan. Name of work View this entry on the original dictionary page scan.
vaiśvadevaprayogam. Name of work View this entry on the original dictionary page scan.
vaiśvadevapūjāf. Name of work View this entry on the original dictionary page scan.
vaiśvadevastutm. a particular ekāha- View this entry on the original dictionary page scan.
vaiśvadevatan. the nakṣatra- uttarāṣāḍhā- (varia lectio -daivata-). View this entry on the original dictionary page scan.
vaiśvadevavidhim. Name of work View this entry on the original dictionary page scan.
vaiśvadevīf. Name of particular sacrificial bricks View this entry on the original dictionary page scan.
vaiśvadevikamfn. relating or sacred to the viśve- devāḥ- etc. (varia lectio -daivivika-) View this entry on the original dictionary page scan.
vaiśvadevikamfn. belonging to the vaiśvadeva- parvan- View this entry on the original dictionary page scan.
vaiśvadevikamfn. corresponding to the vaiśvadeva--deities ceremony View this entry on the original dictionary page scan.
vaiśvadevikamfn. plural Name of particular texts View this entry on the original dictionary page scan.
vaiśvadevyamfn. sacred to the viśve- devāḥ- View this entry on the original dictionary page scan.
vaiśvadhamfn. (fr. viśva-dhā-) gaRa chattrādi-. View this entry on the original dictionary page scan.
vaiśvadhainava va-bhakta- varia lectio for dhenava-, va-bh-. View this entry on the original dictionary page scan.
vaiśvadhenavam. (fr. viśva-dhenu-) View this entry on the original dictionary page scan.
vaiśvadhenavabhaktamfn. gaRa aiṣukāry-ādi-. View this entry on the original dictionary page scan.
vaivadhikam. (fr. vi-vadha-) a carrier, burden-bearer, porter ( vaivadhikatā -tā- f.) View this entry on the original dictionary page scan.
vaivadhikam. hawker who carries wares to sell View this entry on the original dictionary page scan.
vaivadhikatāf. vaivadhika
vaivadhikīf. a female hawker
vajravadham. death by a thunderbolt or by lightning View this entry on the original dictionary page scan.
vajravadham. oblique or cross multiplication View this entry on the original dictionary page scan.
vākpravadiṣumfn. coming forward as a speaker View this entry on the original dictionary page scan.
valīvadanam. a monkey View this entry on the original dictionary page scan.
vāmadevadevyamfn. coming or descended from the ṛṣi- vāma-deva- View this entry on the original dictionary page scan.
vaṃśīvadanam. (with śarman-) Name of an author View this entry on the original dictionary page scan.
varāhavadhrīf. (prob.) a flitch View this entry on the original dictionary page scan.
vāravadhū( ) f. a harlot, prostitute. View this entry on the original dictionary page scan.
vārivadanan. (or wrong reading for) -badara- View this entry on the original dictionary page scan.
varṇivadham. killing or occasioning the death of a man belonging to one of the four castes View this entry on the original dictionary page scan.
vaśaṃvadamfn. (mostly in fine compositi or 'at the end of a compound') submissive to the will of another, obedient, compliant, devoted or addicted to, actuated or transported or overcome with (sv/ecchā-v-,dependent on one's own will) etc. View this entry on the original dictionary page scan.
vaśaṃvadatvan. submission to the will of another, complaisance View this entry on the original dictionary page scan.
vaśaṃvaditamfn. made compliant, fascinated View this entry on the original dictionary page scan.
vāsavadattam. "given by indra-", Name of a man View this entry on the original dictionary page scan.
vāsavadattāf. Name of various women (especially of the wife of udayana-, king of vatsa- and daughter of king caṇḍa-mahā-sena- of ujjayinī-[ ]or of king pradyota-[ ],to whom she offered herself after having been betrothed by her father to saṃjaya-[ ];and of the heroine of subandhu-'s novel, who is represented to have been betrothed by her father to puṣpa-ketu-, but carried off by kandarpa-ketu-) View this entry on the original dictionary page scan.
vāsavadattāf. the story of vāsava-dattā- Va1rtt. 1 (especially as narrated in subandhu-'s tale) View this entry on the original dictionary page scan.
vāsavadatttākhyāyikāf. the story of vāsava-dattā- View this entry on the original dictionary page scan.
vāsavadattteyam. metron. of vāsava-dattā- View this entry on the original dictionary page scan.
vāsavadatttikamfn. acquainted with the story of vāsava-dattā- or studying it on View this entry on the original dictionary page scan.
vāsavadiśf. " indra-'s quarter", the east View this entry on the original dictionary page scan.
vāsudevadvādaśākṣarīf. Name of work View this entry on the original dictionary page scan.
vāvadūkamfn. (fr. Intensive of vad-) talking much, eloquent, garrulous, disputatious View this entry on the original dictionary page scan.
vāvadūkam. Name of a man gaRa kurv-ādi-. View this entry on the original dictionary page scan.
vāvadūkatāf. garrulity, loquaciousness View this entry on the original dictionary page scan.
vāvadūkatvan. idem or 'f. garrulity, loquaciousness ' , eloquence View this entry on the original dictionary page scan.
vāvadūkyam. patronymic fr. vāvadūka-. View this entry on the original dictionary page scan.
vāyvadhikamfn. "having an excess of wind", gouty (wrong reading vāyv-ādh-). View this entry on the original dictionary page scan.
vedamuṇḍavadham. Name of work View this entry on the original dictionary page scan.
vedāntatattvadīpanan. Name of work View this entry on the original dictionary page scan.
vedavadanan. " veda--mouth", introduction to the veda- id est grammar (see -mukha-) View this entry on the original dictionary page scan.
vedavadanan. Name of a place View this entry on the original dictionary page scan.
veśavadhū() f. a common woman, harlot. View this entry on the original dictionary page scan.
vidhivadhūf. "wife of brahmā-", sarasvatī- View this entry on the original dictionary page scan.
vidhuvadanāf. a moon-faced woman View this entry on the original dictionary page scan.
vidvadin compound for vidvat-. View this entry on the original dictionary page scan.
vidvadbhūṣaṇapadyasaṃgraham. Name of work View this entry on the original dictionary page scan.
vidvaddeśīya mfn. equals vidvat-kalpa- View this entry on the original dictionary page scan.
vidvaddeśyamfn. equals vidvat-kalpa- View this entry on the original dictionary page scan.
vidvadvallabham. Name of work View this entry on the original dictionary page scan.
vidvadvinodakāvyan. Name of work View this entry on the original dictionary page scan.
vidvadvinodamañjūṣāf. Name of work View this entry on the original dictionary page scan.
vidvadvivādam. Name of work View this entry on the original dictionary page scan.
vidyāvadhūf. a goddess thought to preside over learning (see vidyādhidevatā-). View this entry on the original dictionary page scan.
vikalavadham. "death of vikala-", Name of a chapter in View this entry on the original dictionary page scan.
vikasitanayanavadanakamalamfn. opening (her) lotus-like eyes and mouth View this entry on the original dictionary page scan.
vikasitavadanamfn. with opened mouth View this entry on the original dictionary page scan.
vikaṭavadanam. "hideous-faced", Name of an attendant of durgā- View this entry on the original dictionary page scan.
vikṛtavadanamfn. having a distorted face, ugly-faced View this entry on the original dictionary page scan.
vipravadP. A1. -vadati-, te-, to speak variously, be at variance, disagree (see ) . View this entry on the original dictionary page scan.
vīraśaivadikṣāvidhānan. Name of work View this entry on the original dictionary page scan.
virocanavadham. Name of a chapter of the View this entry on the original dictionary page scan.
vīryavadānan. effecting anything by prowess View this entry on the original dictionary page scan.
vīryavadānan. plural valour and achievements View this entry on the original dictionary page scan.
vīryāvadhūtamfn. overcome or surpassed in prowess View this entry on the original dictionary page scan.
viṣādārtavadanamfn. looking depressed with care or sorrow View this entry on the original dictionary page scan.
visaṃvadP. -vadati-, to break one's word or promise ; to fail in an agreement, contradict, raise objections : Causal See -saṃvādita-. View this entry on the original dictionary page scan.
viṣaṇṇavadanamfn. equals -mukha- View this entry on the original dictionary page scan.
viṣuvadin compound for vat-. View this entry on the original dictionary page scan.
viṣuvadbhāf. the equinoctial shadow View this entry on the original dictionary page scan.
viṣuvaddeśam. a country situated under the equator, Scholiast or Commentator View this entry on the original dictionary page scan.
viṣuvaddinan. View this entry on the original dictionary page scan.
viṣuvaddivasam. the equinoctial day View this entry on the original dictionary page scan.
viṣuvadinan. the day of the equinox View this entry on the original dictionary page scan.
viṣuvadvalaya n. the equinoctial circle, equator View this entry on the original dictionary page scan.
viṣuvadvṛttan. the equinoctial circle, equator View this entry on the original dictionary page scan.
viśvadaiva n. the lunar mansion or asterism uttarāṣāḍhā- (presided over by the viśve- devāḥ-) View this entry on the original dictionary page scan.
viśvadaivatan. the lunar mansion or asterism uttarāṣāḍhā- (presided over by the viśve- devāḥ-) View this entry on the original dictionary page scan.
viśvadaṃṣṭram. Name of an asura- View this entry on the original dictionary page scan.
viśvadānimfn. all-giving View this entry on the original dictionary page scan.
viśvadānīmind. (see tadānīm-, id-) at all times, at all seasons View this entry on the original dictionary page scan.
viśvadarśatamfn. (viśv/a--) visible to all View this entry on the original dictionary page scan.
viśvadarśatamfn. to be honoured by all View this entry on the original dictionary page scan.
viśvadāsāf. one of the seven tongues of fire View this entry on the original dictionary page scan.
viśvadattam. Name of a brahman- View this entry on the original dictionary page scan.
viśvadāvamfn. all-scorching View this entry on the original dictionary page scan.
viśvadāvanmfn. all-distributing View this entry on the original dictionary page scan.
viśvadāvyamfn. all-scorching View this entry on the original dictionary page scan.
viśvadevamfn. (viśv/a--) all-divine View this entry on the original dictionary page scan.
viśvadevam. Name of a god View this entry on the original dictionary page scan.
viśvadevam. of a teacher View this entry on the original dictionary page scan.
viśvadevam. Pl. a particular class of deities, the viśve- devāḥ- (See viśva-above) View this entry on the original dictionary page scan.
viśvadevāf. Uraria Lagopedioides View this entry on the original dictionary page scan.
viśvadevāf. Hedysarum Lagopedioides View this entry on the original dictionary page scan.
viśvadevāf. a species of red-flowering daṇḍotpala- View this entry on the original dictionary page scan.
viśvadevabhaktamfn. (prob.) inhabited by worshippers of the viśve- devāḥ- (gaRa aiṣukāry-ādi-) View this entry on the original dictionary page scan.
viśvadevadīkṣitīyan. Name of work View this entry on the original dictionary page scan.
viśvadevanetramfn. (viśv/a-deva--) led by the viśve- devāḥ- View this entry on the original dictionary page scan.
viśvadevatāf. plural the viśve- devāḥ- View this entry on the original dictionary page scan.
viśvadevavatmfn. (viśv/a-deva--) united with all gods View this entry on the original dictionary page scan.
viśvadevyamfn. (viśv/a--) relating or sacred or dear etc. to all gods View this entry on the original dictionary page scan.
viśvadevyamfn. distinguished by all divine attributes View this entry on the original dictionary page scan.
viśvadevyāvatmfn. relating or dear to all gods etc. View this entry on the original dictionary page scan.
viśvadevyāvatmfn. accompanied by the viśve- devāḥ- View this entry on the original dictionary page scan.
viśvadhāmfn. (viśv/a--.) (see viśv/adha-,p.994) all-preserving View this entry on the original dictionary page scan.
viśvadhāf. preservation of the universe gaRa chattrādi-. View this entry on the original dictionary page scan.
viśvadha ind. in every way at all times, on every occasion View this entry on the original dictionary page scan.
viśvadhāind. in every way at all times, on every occasion View this entry on the original dictionary page scan.
viśvadhāmann. a universal home View this entry on the original dictionary page scan.
viśvadharamfn. Preserving all things (Name of viṣṇu-) View this entry on the original dictionary page scan.
viśvadharamfn. Name of a man View this entry on the original dictionary page scan.
viśvadhāram. Name of a son of medhātithi- View this entry on the original dictionary page scan.
viśvadhāran. Name of the varṣa- ruled by him View this entry on the original dictionary page scan.
viśvadharaṇan. preservation of the universe View this entry on the original dictionary page scan.
viśvadhārinmfn. all-maintaining View this entry on the original dictionary page scan.
viśvadhārinm. a deity View this entry on the original dictionary page scan.
viśvadhāriṇīf. the earth View this entry on the original dictionary page scan.
viśvadhātṛmfn. all-sustainer View this entry on the original dictionary page scan.
viśvadhāyas(viśv/a--.) mfn. all-sustaining, all-nourishing View this entry on the original dictionary page scan.
viśvadhenamf(ā-)n. (viśv/a--.) all-feeding View this entry on the original dictionary page scan.
viśvadhenāf. Name of the earth View this entry on the original dictionary page scan.
viśvadhenuSee vaiśva-dhenava- and vaiśvadhainava-. View this entry on the original dictionary page scan.
viśvadhṛk mfn. sustaining everything View this entry on the original dictionary page scan.
viśvadhṛtmfn. sustaining everything View this entry on the original dictionary page scan.
viśvadīpam. Name of work View this entry on the original dictionary page scan.
viśvadohas(viśv/a-) mfn. milking or yielding all things View this entry on the original dictionary page scan.
viṣvadrīcīnamfn. (fr. next) being everywhere, general View this entry on the original dictionary page scan.
viśvadṛśmfn. all-seeing View this entry on the original dictionary page scan.
viśvadṛṣṭa(viśv/a--) mfn. seen by all View this entry on the original dictionary page scan.
viṣvadryakind. forth on both or all sides or all directions View this entry on the original dictionary page scan.
viśvadryañc wrong reading for viṣvadryañc-. View this entry on the original dictionary page scan.
viṣvadryañcmf(drīcī-)n. (see tadryañc-, madryañc-) going everywhere or in all directions, all-pervading View this entry on the original dictionary page scan.
viśvavadam. (prob.) = the Visparad View this entry on the original dictionary page scan.
vivadP. A1. (see ) -vadati-, te-, (P.) to contradict, oppose (accusative) ; (P. A1.) to be at variance, contest, litigate, dispute with (instrumental case,rarely accusative) or about (locative case,rarely accusative) etc. etc. (Ved. infinitive mood -vade-with yā-,"to be about to quarrel"; pr. p. A1. -vadamāna-,"disputing","disputed","questionable") ; (P.) to talk, converse ; (A1.) to raise the voice, sing (said of birds) : Causal -vādayati-, to dispute or litigate, commence an action or lawsuit : Intensive (only parasmE-pada v/āvadat-), to roar aloud View this entry on the original dictionary page scan.
vivadanan. contest, quarrel, litigation View this entry on the original dictionary page scan.
vivādatattvadīpam. Name of work View this entry on the original dictionary page scan.
vivadh(only Aorist vy-/avadhīt- subjunctive vi-vadhiṣaḥ-), to destroy utterly View this entry on the original dictionary page scan.
vivadham. or vī-vadha- (prob. fr. vadh- equals vah-; see vadhu-) a shoulder-yoke for carrying burdens etc. (see vi--and sav-) View this entry on the original dictionary page scan.
vivadham. a store of grain or hay, provisions etc. View this entry on the original dictionary page scan.
vivadham. a particular ekāha-, View this entry on the original dictionary page scan.
vivadham. a road, highway (vīv- on Va1rtt. 1) View this entry on the original dictionary page scan.
vivadham. a ewer, pitcher View this entry on the original dictionary page scan.
vivadham. the income which a king obtains from his subjects View this entry on the original dictionary page scan.
vīvadhāf. (vīvadhā-) a yoke (figuratively) id est chain, fetters (see vṛddha-v-). View this entry on the original dictionary page scan.
vīvadha vī-vadhika-, vī-vidha-, vī-vṛta- = vi-vadha- etc., qq.vv. View this entry on the original dictionary page scan.
vivadhika mf(ī-)n. one who carries a burden on a shoulder-yoke View this entry on the original dictionary page scan.
vivadhikam. a dealer, pedlar, hawker View this entry on the original dictionary page scan.
vīvadhikamf(ī-)n. one who carries a burden on a shoulder-yoke View this entry on the original dictionary page scan.
vīvadhikam. a dealer, pedlar, hawker View this entry on the original dictionary page scan.
vivadiṣṇuSee a-vivadiṣṇu-. View this entry on the original dictionary page scan.
vivaditamfn. disputing, quarrelling View this entry on the original dictionary page scan.
vivaditamfn. disputed, controverted, litigated View this entry on the original dictionary page scan.
vivaditavyan. (impersonal or used impersonally) it is to be disputed about (locative case), View this entry on the original dictionary page scan.
vivāhatattvadīpikāf. Name of work View this entry on the original dictionary page scan.
vivaraṇatattvadīpanan. Name of work View this entry on the original dictionary page scan.
vivarṇavadanamfn. pale-faced View this entry on the original dictionary page scan.
vivasvadvātamf(ā-)n. (prob.) loved by vivasvat- View this entry on the original dictionary page scan.
vivivadha(v/i--) mfn. not counterpoising View this entry on the original dictionary page scan.
vivīvadhamfn. equals -vivadha- View this entry on the original dictionary page scan.
vivṛttavadanamf(ā-)n. bending or turning the face View this entry on the original dictionary page scan.
vrajavadhū() f. equals -rāmā-. View this entry on the original dictionary page scan.
vṛddhavīvadhāf. "yoke of the ancients", the bonds of traditional usage View this entry on the original dictionary page scan.
vṛkāsuravadham. "killing of the asura- vṛka-"Name of a chapter of View this entry on the original dictionary page scan.
vṛtravadham. the killing of vṛtra- (also Name of a drama and of particular chapters of the and the ) View this entry on the original dictionary page scan.
vyāghravadhūf. a tigress View this entry on the original dictionary page scan.
vyaktāvadhūtamfn. one who has publicly shaken off worldly ties (opp. to guptāv- q.v) View this entry on the original dictionary page scan.
vyavadā(or do-;only ind.p. -dayā-), to cut in two, divide View this entry on the original dictionary page scan.
vyavadai Passive voice -dāyate- (p. -dāyamāna-), to be clearly diffused View this entry on the original dictionary page scan.
vyavadānan. purification View this entry on the original dictionary page scan.
vyavadāraprāpaṇan. the attainment of full age, View this entry on the original dictionary page scan.
vyavadhāP. A1. -dadhāti-, -dkatte-, to place apart or asunder ; to put or place between, interpose ; to leave out, omit, ; to separate, divide, interrupt : Passive voice -dhīyate-, to be separated or divided or interrupted : Causal , -dhāpayati-, to separate View this entry on the original dictionary page scan.
vyavadhāf. covering or anything that covers View this entry on the original dictionary page scan.
vyavadhānan. intervening, intervention (especially in gram."the intervention of a syllable or letter") ( vyavadhānena nena- ind.="indirectly") View this entry on the original dictionary page scan.
vyavadhānan. obstruction, hiding from view View this entry on the original dictionary page scan.
vyavadhānan. covering, a cover, screen View this entry on the original dictionary page scan.
vyavadhānan. separation, division View this entry on the original dictionary page scan.
vyavadhānan. interruption View this entry on the original dictionary page scan.
vyavadhānan. cessation, termination View this entry on the original dictionary page scan.
vyavadhānan. interval, space View this entry on the original dictionary page scan.
vyavadhānavatmfn. (in fine compositi or 'at the end of a compound') covered with View this entry on the original dictionary page scan.
vyavadhānenaind. vyavadhāna
vyavadhāraṇan. a special definition or designation View this entry on the original dictionary page scan.
vyavadhāvP. -dhāvati-, to run in different directions, separate ; to run away, flee from (ablative)
vyavadhāyakamf(ikā-)n. intervening, interposing, separating View this entry on the original dictionary page scan.
vyavadhāyakamf(ikā-)n. interrupting, disturbing View this entry on the original dictionary page scan.
vyavadhāyakamf(ikā-)n. concealing, screening, hiding View this entry on the original dictionary page scan.
vyavadhāyakavadhāyika wrong reading for prec. View this entry on the original dictionary page scan.
vyavadheyamfn. to be put in between or interposed View this entry on the original dictionary page scan.
vyavadhim. covering, concealing, intervention View this entry on the original dictionary page scan.
vyavadhṛP. -dhārayati-, to fix, settle, establish View this entry on the original dictionary page scan.
vyavadhūP. A1. -dhūnoti-, nute-, to shake off, ward off, remove ; to shake about, treat roughly or rudely ; to reject, repel View this entry on the original dictionary page scan.
vyavadhūtamfn. one who has shaken off all wordly desires, indifferent in regard to life, resigned View this entry on the original dictionary page scan.
vyavadīrṇamfn. ( dṝ-) burst asunder, broken to pieces, distracted View this entry on the original dictionary page scan.
vyavadruP. -dravati-, to run away View this entry on the original dictionary page scan.
vyavavadP. A1. -vadati-, te-, to speak ill of. decry ; to begin to speak, break silence () View this entry on the original dictionary page scan.
vyavavadātamfn. clean, clear, bright View this entry on the original dictionary page scan.
vyavavadhāraṇan. accurate determination View this entry on the original dictionary page scan.
vyavavadhātavyan. (impersonal or used impersonally) it is to be separated or divided View this entry on the original dictionary page scan.
vyavavadyamfn. to be spoken ill of or decried View this entry on the original dictionary page scan.
yadavadhiind. since which time View this entry on the original dictionary page scan.
yadvadamfn. talking anything, saying no matter what View this entry on the original dictionary page scan.
yajñadattavadham. " yajña-datta-'s death", Name of an episode of the rāmāyaṇa- View this entry on the original dictionary page scan.
yathākāmavadhyamfn. to be chastised or punished at pleasure View this entry on the original dictionary page scan.
yathāvadānam(thāv-) ind. part by part, portion by portion View this entry on the original dictionary page scan.
yathāvadgrahaṇan. right comprehension View this entry on the original dictionary page scan.
yatisvadharmabhikṣāvidhim. Name of a work (containing rules for the regulation of life on the part of religious mendicants, attributed to śaṃkarācārya-). View this entry on the original dictionary page scan.
yāvadin compound for yāvat-. View this entry on the original dictionary page scan.
yāvadabhīkṣṇamind. for a moment's duration View this entry on the original dictionary page scan.
yāvadābhūtasamplavamind. up to the dissolution of created things, to the end of the world View this entry on the original dictionary page scan.
yāvadadhyayanamind. during the recitation View this entry on the original dictionary page scan.
yāvadādiṣṭamfn. as much as related View this entry on the original dictionary page scan.
yāvadahan. the corresponding day ("the how-manieth day") View this entry on the original dictionary page scan.
yāvadāhūtasamplavamind. wrong reading for -ābhūta-s- above View this entry on the original dictionary page scan.
yāvadamatramind. corresponding to the number of the vessels View this entry on the original dictionary page scan.
yāvadaṅgīnamfn. having as large a member or limb View this entry on the original dictionary page scan.
yāvadantam() () ind. as far as the end, to the last. View this entry on the original dictionary page scan.
yāvadantāya() ind. as far as the end, to the last. View this entry on the original dictionary page scan.
yāvadantyamfn. life-long, lasting for life View this entry on the original dictionary page scan.
yāvadarthamfn. as many as necessary, corresponding to requirement View this entry on the original dictionary page scan.
yāvadarthamfn. devoted to anything (locative case), as much as is necessary View this entry on the original dictionary page scan.
yāvadartha in the beginning of a compound as much as may be useful, according to need. () View this entry on the original dictionary page scan.
yāvadarthamind. () as much as may be useful, according to need. View this entry on the original dictionary page scan.
yāvadaupamyan. a mere comparison View this entry on the original dictionary page scan.
yāvadāvāsamfn. having as many abodes (correl. to tāvad-- āv-), View this entry on the original dictionary page scan.
yāvadāyuḥpramāṇamfn. measured by the duration of life, lasting for life View this entry on the original dictionary page scan.
yāvadāyusind. idem or 'ind. as long as life lasts, for the whole of life ' View this entry on the original dictionary page scan.
yāvadāyuṣamind. as long as life lasts, for the whole of life View this entry on the original dictionary page scan.
yāvadbalamind. as far as strength goes, with all one's might commentator or commentary View this entry on the original dictionary page scan.
yāvadbhāṣitamfn. as much as has been said View this entry on the original dictionary page scan.
yāvaddehabhāvinmfn. lasting as long as the body, sāṃkhya-s. Scholiast or Commentator View this entry on the original dictionary page scan.
yāvaddevatyamfn. directed to as many divinities View this entry on the original dictionary page scan.
yāvaddeya in the beginning of a compound (in law) until paying a debt. View this entry on the original dictionary page scan.
yāvaddhāind. as often, as many times View this entry on the original dictionary page scan.
yāvaddhavis(for -havis-) ind. according to the number of oblations View this entry on the original dictionary page scan.
yāvadgamamind. as fast as one can go View this entry on the original dictionary page scan.
yāvadgrahaṇamind. until taking View this entry on the original dictionary page scan.
yāvadgrahanaṃind. (also) until understanding, View this entry on the original dictionary page scan.
yāvadgrahanaṃas long as possible, View this entry on the original dictionary page scan.
yāvadgṛhītinmfn. as often as one has taken or ladled out View this entry on the original dictionary page scan.
yāvadicchamind. according to desire View this entry on the original dictionary page scan.
yāvadīpsitamind. as far as agreeable, as much as desired View this entry on the original dictionary page scan.
yāvadiṣṭakamind. according to the number of bricks View this entry on the original dictionary page scan.
yāvadiṣṭamind. next View this entry on the original dictionary page scan.
yāvaditthamind. as much as necessary (varia lectio) View this entry on the original dictionary page scan.
yāvadrājyamind. for the whole reign View this entry on the original dictionary page scan.
yāvaduktamfn. as much as stated View this entry on the original dictionary page scan.
yāvaduktamind. View this entry on the original dictionary page scan.
yāvadupaniṣad(?) f. Name of work View this entry on the original dictionary page scan.
yāvaduttamamind. up to the furthest limit or boundary View this entry on the original dictionary page scan.
yāvadvacanamind. as far as the statement goes,
yāvadvedamind. as much as gained or obtained View this entry on the original dictionary page scan.
yāvadviṃśatimfn. up to 20, to the 20th View this entry on the original dictionary page scan.
yavadvīpam. the island yava- (varia lectio jala-d-) View this entry on the original dictionary page scan.
yāvadvīryavat(y/āvad--) mfn. as far as possessed of power, as effective View this entry on the original dictionary page scan.
yāvadvyāptiind. to the utmost reach or extent View this entry on the original dictionary page scan.
yāvadyajusmfn. as far as the yajus- extends View this entry on the original dictionary page scan.
yugāvadhim. end or destruction of the world View this entry on the original dictionary page scan.
yuvaddevatyamfn. having (both of) you for a divinity View this entry on the original dictionary page scan.
yuvadhita(yuv/a--) mfn. placed or arranged by you both View this entry on the original dictionary page scan.
yuvadrikind. directed towards both of you View this entry on the original dictionary page scan.
Apte Search
115 results
vad वद् 1 P. (वदति, but Ātm. in certain senses and with certain prepositions; see below; उवाद, अवादीत्, वदिष्यति, व दितुम्, उदित; pass. उद्यते desid. विवदिषति) 1 To say, speak utter, address, speak to; वद प्रदोषे स्फुटचन्द्रतारका विभावरी यद्यरुणाय कल्पते Ku.5.44; वदतां वरः R.1.59 'the foremost of the eloquent'. -2 To announce, tell, communicate, inform; यो गोत्रादि वदति स्वयम्. -3 To speak of, describe; आश्चर्यवद्वदति तथैव चान्यः Bg.2.29. -4 To lay down, state; श्रुतिस्मृत्युदितं धर्ममनुतिष्ठन् हि मानवः Ms.2.9;4.14. -5 To name, call; वदन्ति वर्ण्यावर्ण्यानां धर्मैक्यं दीपकं बुधाः Chandr.5. 45; तदप्यपाकीर्णमतः प्रियवदां वदन्त्यपर्णेति च तां पुराविदः Ku.5. 28. -6 To indicate, bespeak; कृतज्ञतामस्य वदन्ति संपदः Ki. 1.14. -7 To raise the voice, utter a cry, sing; कोकिलः पञ्चमेन वदति; वदन्ति मधुरा वाचः; &c. -8 To show brilliance or proficiency in, be an authority of (Ātm.); शास्त्रे वदते Sk., पाणिनिर्वदते Vop. -9 To shine, look splendid or bright (Ātm.); लङ्का समाविशद् रात्रौ वदमानो$रिदुर्गमाम् Bk. 8.27. -1 To maintain, affirm. -11 To toil, exert, labour (Ātm.); क्षेत्रे वदते Sk. -Caus. (वादयति, ते) 1 To cause to speak or say. -2 To cause to sound, play on a musical instrument; वीणामिव वादयन्ती Vikr.1.1; वादयते मृदु वेणुम् Gīt.5. -3 To speak, recite.
vada वद a. Speaking, talking, speaking well.
vadālaḥ वदालः 1 A whirlpool. -2 A kind of sheat-fish.
vadāmaḥ वदामः An almond.
vadanam वदनम् [उद्यते$नेन वद् करणे ल्युट्] 1 The face; आसीद्वि- वृत्तवदना च विमोचयन्ती Ś.2.13; so सुवदना, कमलवदना &c. -2 The mouth; वदने विनिवेशिता भुजङ्गी पिशुनानां रसनामिषेण धात्रा Bv.1.111. -3 Aspect, look, appearance. -4 The front point. -5 First term (in a series). -6 The summit or apex of a triangle. -Comp. -आसवः saliva. -उदरम् the jaws. -कञ्जम्, पङ्कजम् a lotus-face. -पवनः breath. -मालिन्यम् 1 a troubled face. -2 shame-faced appearance. -श्यामिका 1 blackness of the face. -2 a kind of disease.
vadantiḥ वदन्तिः f. वदन्ती 1 Speech, discourse. -2 A story; L. D. B.
vadanuḥ वदनुः [वद्-चनुङ् Uṇ.3.51] An orator.
vadanya वदन्य a. See वदान्य.
vadānya वदान्य a. [वद्-आन्यः Uṇ.3.13] 1 Speaking fluently, eloquent. -2 Speaking kindly or affably. -3 Liberal, munificent, generous; श्रोत्रियस्य कदर्यस्य वदान्यस्य च वार्धुषेः Ms.4.224. -न्यः A liberal or generous person, munificent or bountiful man; शिरसा वदान्यगुरवः सादरमेनं वहन्ति सुरतरवः Bv.1.19; or तस्मै वदान्यगुरवे तरवे नमो$स्तु 1.94; N.5. 11; R.5.24.
vadara वदर See बदर.
vadāvada वदावद a. [अत्यन्तं वदति वद्-अच् नि˚] 1 A speaker, eloquent; सुभगमभिधास्यत्युद्दामा पराङ्कवदावदः N. 19.24. -2 Talkative, garrulous; यत्र यद् व्यञ्जयामास महमूदो वदावदः Śiva B.15.45.
vadh वध् 1 P. (वधति) To slay, kill (not used in classical Sanskrit except as a substitute for हन् in the Aorist and Benedictive).
vadhaḥ वधः 1 Killing, murder, slaughter, destruction; आत्मनो वधमाहर्ता क्वासौ विहगतस्करः V.5.1; मनुष्यवधः homicide; पशुवधः &c. -2 A blow, stroke; पुनरज्ञातचर्यायां कीचकेन पदा वधम् Mb.12.16.21; Ms.8.267. -3 Paralysis. -4 Disappearance. -5 Multiplication (in math.). -6 A killer, slayer. -7 A vanquisher, victor. -8 Ved. A deadly weapon, such as Indra's thunderbolt. -9 (In law) A capital or corporal punishment. -1 Frustration. -11 Defect, imperfection. -12 (In alg.) A product. -Comp. -अङ्गकम् a prison. -अर्थीय a. = वध्य q. v.; वधक q. v.; वधार्थीयं क्षत्रिया राजपुत्री (गर्भं धत्ते) Mb.11. 26.5. -अर्ह (ण) a. deserving capital punishment; ब्रह्मबन्धुर्न हन्तव्य आततायी वधार्हणः Bhāg.1.7.53. -उदर्क a. resulting in death, proving fatal. -उद्यत a. 1 murderous. -2 an assassin. -उपायः a means of killing; हन्या- च्चित्रैर्वधोपायैः Ms.9.248. -कर्माधिकारिन् m. a hangman, an executioner. -जीविन् m. 1 a hunter. -2 a butcher. -दण्डः 1 corporeal punishment (as whipping &c.). -2 capital punishment; वधदण्डमतः परम् Ms.8.129. -निग्रहः capital punishment. -निर्णेकः atonement for murder; दानेन वर्धानर्णेकम् Ms.11.139. -भूमिः f., -स्थली f., -स्थानम् 1 a place of execution. -2 a slaughter-house. -स्तम्भः the gallows; Mk.1.
vadhaka वधक a. (-धका, -धिका f.) [हनः क्वुन्, वध च Uṇ.2.35] Killing, destructive, injurious. -कः 1 An executioner, a hangman. -2 A murderer, an assassin. -3 A kind of reed.
vadhanā वधना Ved. A deadly weapon.
vadhar वधर् n. A destructiue weapon; अव रुद्रा अशसो हन्तना वधः Rv.2.34.9.
vadhatram वधत्रम् [वधू-अत्रन् Uṇ.3.14] A deadly weapon.
vadhikaḥ वधिकः कम् musk.
vadhitram वधित्रम् 1 The god of love. -2 Sexual passion, lust.
vadhram वध्रम् 1 A leathern strap or thong; see वर्ध्रम्. -2 Lead. -ध्री A leathern thong.
vadhri वध्रि a. Castrated, emasculated.
vadhrikā वध्रिका m. A castrated person, eunuch.
vadhū वधू (धु) टी 1 A young woman or female; रथं वधूटी- मारोप्य पापः क्वाप्येष गच्छति Mv.5.17; गोपवधूटीदुकूलचौराय (कृष्णाय) Bhāṣā P.1. -2 A daughter-in-law. -Comp. -शयनम् a lattice, window.
vadhuḥ वधुः f., -वधुका 1 A daughter-in-law. -2 A young woman in general.
vadhūḥ वधूः f. [उह्यते पितृगेहात् पतिगृहं वह्-ऊधुक् च; cf. Uṇ.1.83] 1 A bride; वरः स वध्वा सह राजमार्गं प्राप ध्वजच्छायनिवारितो- ष्णम् R.7.4,19; समानयंस्तुल्यगुणं वधूवरं चिरस्य वाच्यं न गतः प्रजापतिः Ś.5.15; Ku.6.82. -2 A wife, spouse; इथ नमति वः सर्वांस्त्रिलोचनवधूरिति Ku.6.89; R.1.9. -3 A daughter-in-law; एषा च रघुकुलमहत्तराणां वधूः U.4;4. 16; तेषां वधूस्त्वमसि नन्दिनि पार्थिवानाम् 1.9. -4 A female, maiden, woman in general; हरिरिह मुग्धवधूनिकरे विलासिनि विलसति केलिपरे Gīt.1; स्वयशांसि विक्रमवतामवतां न वधूष्वघानि विमृशन्ति धियः Ki.6.45; N.22.47; Me.16,49,67. -5 The wife of a younger relation, a younger female relation. -6 The female of any animal; मृगवधूः a doe; व्याघ्रवधूः, गजवधूः &c. -Comp. -कालः The time during which a woman is held to be a bride. -गृहप्रवेशः, -प्रवेशः the ceremony of a bride's entrance into her husband's house. -जनः a wife; female, woman. -पक्षः the party of the bride (at a wedding). -वरम् a newly married couple. -वस्त्रम् bridal apparel, nuptial attire. -वासस् n. a bride's undergarment.
vadhūsarā वधूसरा N. of a river; वितस्ता सरयूश्चापि तमसा च वधूसरा Siva B.6.56.
vadhūṭaśayanaḥ वधूटशयनः A lattice, window.
vadhya वध्य a. 1 To be killed or slain. -2 Sentenced to be killed. -3 Vulnerable. -4 To be subjected to corporeal punishment, to be corporeally punished -ध्यः 1 A victim, one seeking his doom; अद्यापि बध्यमानां वध्यः को नेच्छति शिखां मे Mu.1.9. -2 An enemy. -Comp. -दिण्डिमः, -पटहः a drum beaten at the time of execution. -पालः a jailer. -भूः, -भूमिः f., -स्थलम्, -स्थानम् a place of execution. -माला a garland of flowers placed on a person who is about to be executed. -वासस् the clothes of a criminal who has been executed; वध्यांश्च हन्युः सततं यथाशास्त्रं नृपाज्ञया । वध्यवासांसि गृह्णीयुः शय्याश्चाभरणानि च ॥ Ms.1.56. -शिला 1 an executioner's block, scaffold. -2 a slaughter-house.
vadhyā वध्या Killing, slaughter, murder.
vadhऱ्yaḥ वध्ऱ्यः A shoe.
vadi वदि ind. In the dark half (of a lunar month); as in ज्येष्ठवदि (opp. सुदि).
vadya वद्य a. 1 Fit to be spoken, not blamable; cf. अवद्य. -2 Dark or second (said of the fortnight of a lunar month; वद्यपक्षः the dark fortnigt). -द्यम् Speech, speaking about.
aṃhasvad अंहस्वद् a. Sinful.
anavadya अनवद्य n. [न अवद्यः निन्द्यः] Faultless, blameless, unobjectionable, irreproachable; किमु धनैर्विद्यानवद्या यदि Bh. 2.17; उदवहदनवद्यां तामवद्यादपेतः R.7.7. -द्या N. of a damsel. -Comp. -अङ्ग, -रूप a. having faultless limbs or from, exquisitely handsome; रूपस्य अनवद्यता M.2. (-अङ्गी) a woman with a faultless form. -रागः a. variety of gems. Kau. A.2.11.
anavadrāṇa अनवद्राण a. Not sleepy.
anavadhāna अनवधान a. [न. ब.] Careless, inattentive. -नम् Inadvertence, inattention; ˚ता carelessness, remissness in duty (प्रमाद); कर्तव्याकरणं यत्राकर्तव्यस्याथवा क्रिया । उच्यते द्वितयं तत्र प्रमादो$नवधानता ॥.
anavadhi अनवधि a. Unlimited, infinite.
anuvad अनुवद् 1 P. 1 To imitate in speaking, mock (with acc.); गिरं नः...अनुवदति शुकस्ते मञ्जुवाक् पञ्जरस्थः R.5.74 repeat; उक्तमनुवदति Sk.; (P. & A.) to resound, echo; अनुवदति वीणा P.I.3.49 Sk. अनुवदते कठः कलापस्य ibid.; सभा- भित्तिप्रतिध्वानैर्भयादन्ववदन्निब Śi.2.67 echoed and approved also; घोषस्यान्ववदिष्टेव लङ्का पूतक्रतोः पुरः Bk.8.29. -2 To repeat or say again by way of explanation, illustration or corroboration; see Kull. on Ms.1.74;2.6. -3 To repeat, tell, say (generally); निजमनोरथमनुबदन्त्या Dk.21. -4 To abuse, rail at. -Caus. To cause to resound or echo.
anuṣvadha अनुष्वध a. [स्वधामनु, स्वधया सहितः] Accompanied by food. -धम् adv. 1 Through or after food. -2 According to food; after every sacrifice. -3 Voluntarily, according to one's will.
apavad अपवद् 1 U. 1 To revile, abuse, censure, reproach; परानमी यदपवदन्त आत्मनः Śi.17.19; नार्तो$प्यपवदेद्विप्रान् Ms. 4.236; स्वं पुत्रं अपवदति-ते वा P.I.3.77. Sk. (क्रियाफलस्य कर्तृगामित्वे द्योतिते वा स्यात्); नृभ्यो$पवदमानस्य Bk.8.45 reviling or abusing men. -2 To disown, deny (A.); न्याय- मपवदते P.I.3.73 Sk. -3 To argue out, refute, contradict; अपवदेयुस्तानितिहासैः पुरातनैः Y.3.7. -Caus. 1 To blame, censure. -2 To oppose or contradict as unadvisable.
abhivad अभिवद् 1 U. 1 To speak to, address; परस्त्रियं यो$भिव- देत्तीर्थे$रण्ये वने$पि वा Ms.8.356; Y.2.31. -2 To speak of or with reference to, tell, declare, mention; यत्कर्म क्रियमाणं ऋगभिवदति Ait. Br. -3 To express, utter, signify; यद्वाचा$नभ्युदितं येन वागभ्युद्यते । तदेव ब्रह्म त्वं विद्धि नेदं यदिदमुपासते Ken.1.4. -4 To name, call. -5 To salute, greet; see caus. -caus. 1 To greet or salute respectfully, oft, with the mention of the person saluted and the person who salutes; तात प्राचेतसान्तेवासी लवो$भिवादयते U.6. भगवन्नभिवादये V.5; see अभिवाद also. -2 To cause to salute (with acc. or instr. of agent of action); अभि- वादयते देवं भक्तं भक्तेन वा. -3 To utter, pronounce. -4 To play on an instrument.
abhivadanam अभिवदनम् 1 Addressing &c. -2 Salutation.
abhyavadānya अभ्यवदान्य Ved. Not liberal.
āragvadhaḥ आरग्वधः The tree Cassia Fistula (Mar. बाहवा) largely used in medicinal recipes. -धम् Its fruit.
ārgvadha आर्ग्वध = आरग्वध. q. v.
āsvad आस्वद् 1 Ā. To taste. -Caus. To taste, enjoy, संभोगं Me.89; R.3.54; (fig.) to plunder, defraud; नास्वाद्यसे भुजङ्गैः K.19.
upavad उपवद् 1 Ā. 1 To talk over, conciliate. -2 To flatter, cajole, coax; भृत्यानुपवदते Sk.; दातारम् Bk.8.28.
ūvadhyam ऊवध्यम् Half digested food; Bṛi. Up.1.1.1. उवध्य- गोहं पार्थिवं रवनतात् T. Br.
evāvada एवावद a. Ved. So speaking, true. -दः N. of a Ṛiṣi; Rv.5.44.1.
aurdhvadeham और्ध्वदेहम् [ऊर्ध्वदेह-अण्] A funeral ceremony; और्ध्वदेहनिमित्तार्थमवतीर्योदकं नदीम् Rām.2.83.24. और्ध्वदे aurdhvadē (दै dai) हिक hika और्ध्वदे (दै) हिक a. (-की f.) [ऊर्ध्वदेहाय साधु ठञ् P.IV.3.6 Vārt.1] 1 Relating to a deceased person, funeral, performed in honour of the dead (as a rite); ˚क्रिया obsequies, funeral rites; Pt.1. -2 Pertaining to ब्रह्म; जनको जनदेवस्तु मिथिलायां जनाधिपः । और्ध्वदेहिकर्धमाणा- मासीद्युक्तो विचिन्तने ॥ Mb.12.218.3. -कम् Funeral rites, obsequies. भृत्यानामुपरोधेन यत्करोत्यौर्ध्वदेहिकम् Ms.11.1. -2 Requisite for future world (such as यज्ञ, दान); अधर्मो- पार्जितैरर्थैर्यः करोत्यौर्ध्वदैहिकम् Mb.5.39.67. और्ध्वस्रो aurdhvasrō (श्रो śrō) तसिकः tasikḥ और्ध्वस्रो (श्रो) तसिकः = शैवः, a Śaiva or an adherent of the sect.
tāvaddhā तावद्धा ind. 1 In such a number. -2 So often.
tvad त्वद् A form of the second personal pronoun occurring as the first member of some compounds; e. g. त्वदधीन, त्वत्सादृश्यम् &c.
tvadīya त्वदीय a. Thy, thine, your, yours; पितुस्त्वदीयस्य मयापहारितः R.3.5; त्वदीयपादपङ्कजं नमामि देवि नर्मदे.
tvadvidha त्वद्विध a. Like thee or you.
devadryañca देवद्र्यञ्च a. (-द्रीची f.) Adoring a deity.
navadhā नवधा ind. In nine ways, ninefold.
parivad परिवद् 1 P. To abuse, censure, revile.
parivadanam परिवदनम् 1 Reviling. -2 Clamouring.
paryavadāta पर्यवदात a. 1 Perfectly pure or clean. -2 Very accomplished, conversant with. -3 Very familiar, well known.
paryavadānam पर्यवदानम् Complete destruction or disappearance.
paryavadhāraṇam पर्यवधारणम् Precise determination.
parśvadhaḥ पर्श्वधः See परश्वध.
prativad प्रतिवद् 1 P. 1 To speak in reply, answer; प्रियंवदः प्रत्यवदत् सुरेश्वरम् R.3.64. -2 To speak, utter. -3 To repeat. -4 To speak in opposition; किंचित् किंचित् प्रति- वदंस्तूष्णीमासं मुहुर्मुहुः Mb.5.136.14.
prativadh प्रतिवध् 1 P. To beat back, ward off.
pravad प्रवद् 1 P. 1 To say, speak, utter. -2 To speak to, address; सुग्रीवः प्रावदन् नृपम् Bk.7.24. -3 To name, call. -4 To regard, consider. -5 To converse or talk with. -6 To proclaim, declare. -Caus. 1 To cause to speak. -2 To play on (a musical instrument).
pravadanam प्रवदनम् Ved. A proclamation, announcement.
priyaṃvada प्रियंवद a. Sweet-speaking, speaking kindly, affable in address, agreeable; तदप्यपाकीर्णमतः प्रियंवदां वदन्त्यपर्णेति च तां पुराविदः Ku.5.28; R.3.64. -दः 1 A kind of bird. -2 N. of a Gandharva.
bhagavadīyaḥ भगवदीयः A worshipper of Viṣṇu.
bhavadīya भवदीय a. Your honour's, your, thine.
bhuvadvat भुवद्वत् m. pl. An epithet of the Ādityas.
vaśaṃvada वशंवद a. Obedient to the will of, compliant, submissive, subject, under the influence of (lit. and fig.). कोपस्य किं नु करभोरु वशंवदा$भूः Bv.3.9;2.136,157; N.1.33; सा ददर्श गुरुहर्षवशंवदवदनमनङ्गनिंवासम् Gīt.11; अभि- सारयते कान्तं या मन्मथवशंवदा S. D; कम्रामिच्छुर्वशंवदाम् Bk.4.2.
vāvadūka वावदूक a. [वद् यङ् लुक्-ऊकञ्] 1 Talkative, garrulous. -2 Eloquent.
vivad विवद् 1 Ā. 1 To quarrel, dispute; परस्परं विवदमानौ भ्रातरौ. -2 To be at variance, to conflict, be in opposition; परस्परं विवदमानानां शास्त्राणाम् H.1. -3 To contend (as in a court of law).
vivadanam विवदनम् Quarrel, litigation.
vivadhaḥ विवधः 1 A yoke for carrying burdens. -2 A road, high-way. -3 A load, burden. -4 Storing grain; provisions. -5 A pitcher. -6 The income which a king obtains from his subjects.
vivadhikaḥ विवधिकः 1 A carrier of loads, porter. -2 A pedlar, hawker.
vivadhā विवधा 1 A yoke. -2 Chain of fetters.
vivadha विवध a. Various, diverse, manifold, multiform, sundry; सो$भिध्याय शरीरात् स्वात् सिसृक्षुर्विविधाः प्रजाः Ms.1. 8,39. -धम् A variety of action or gesture.
viśvadānīm विश्वदानीम् ind. Ved. At all times.
visaṃvad विसंवद् 1 P. 1 To be inconsistent, be at variance; कमलानां मनोहराणामपि रूपाद्विसंवदति शीलम् Mu.1.19; शकट- दासस्तु मित्रमिति विसंवदन्त्यक्षराणि Mu.5. -2 To break one's word or promise. -3 To disappoint, deceive. -4 To fail. -5 To assert falsely. -6 To contradict. -Caus. 1 To make inconsistent. -2 To disappoint, to cause to fail; रमणीयो$वधिर्विधिना विसंवादितः Ś.6. -3 To fail to prove.
vīvadhaḥ वीवधः 1 A yoke for carrying burdens. -2 A burden. -3 Store of corn etc.; रुध्यध्वं निर्विषासूञ्शिशुयुवतिजानान् वीवधांश्चाद्रियध्वम् Mv.6.16; Śi.2.64. -4 A way, road; अज्ञातवीवधासारतोयशस्यो व्रजेत्तु यः Pt.3.41.
vīvadhikaḥ वीवधिकः 1 A man who carries loads by means of a yoke. -2 A general dealer.
vaivadhikaḥ वैवधिकः 1 A pedlar, hawker. -2 A carrier of loads on a pole. -3 A messenger doing various jobs; अथ वैवधिकस्तूर्णं विसृष्टः शिवभूभृता Śiva B.31.5.
vaiśvadeva वैश्वदेव a. (-वी f.) 1 Belonging to the Viśvedevas, q. v.; Mb.12.31.8. -वम् [विश्वेभ्यो देवेभ्यो देयो बलिः अण्] 1 An offering made to the Viśvedevas. -2 An offering to all deities (made by presenting oblations to fire before meals). -वी The eighth day of the second half of Māgha.
vyavadāta व्यवदात a. Clear, clean.
vyavadānam व्यवदानम् Purification; Buddh.
vyavadīrṇa व्यवदीर्ण p. p. Distracted.
vyavadhā व्यवधा 3 U. 1 To place between, interpose, intervene; प्रेक्ष्य स्थितां सहचरीं व्यवधाय देहम् R.9.57. -2 To hide, conceal, screen; शापव्यवहितस्मृतिः Ś.5. -3 To separate, divide. -4 To obstruct, interrupt. -5 To neglect, omit, pass over; see व्यवहित also.
vyavadhā व्यवधा 1 That which intervenes. -2 A cover, screen, partition. -3 Concealment.
vyavadhānam व्यवधानम् 1 Intervention, interposition, separation; इह समाप्तस्य सामिधेनीवाक्यस्य अस्य चोपव्ययते इति वचनस्य निविदां विधायकेन ... ग्रन्थेन व्यवधानं भवति ŚB. on MS.3.1.21. -2 Obstruction, hiding from view; दृष्टं विमानव्यवधानमुक्तां पुनः सहस्रार्चिषि संनिधत्ते R.13.44. -3 Concealment, disappearance. -4 A screen, partition. -5 A cover, covering; शार्दूलचर्मव्यवधान- वत्याम् Ku.3.44. -6 Interval, space. -7 (In gram.) The intervention of a syllable or letter. -8 (In Mīmāṁsā) Remote construction, remoteness; see व्यवहित- कल्पना; व्यवधानाल्लक्षणापि ज्यायसी ŚB. on MS.1.2.69; व्यवधानादर्थो बलीयान् ŚB. on MS.6.4.23.
vyavadhāyaka व्यवधायक a. (-यिका f.) 1 Intervening, screening, covering. -2 Obstructing, hiding. -3 Intermediate.
vyavadhiḥ व्यवधिः Covering, intervention &c.; दिशमुदधिव्यवधिं समेतसीताम् Bk.1.51; अवनतवदनेन्दुरिच्छतीव व्यवधिमधीरतया यदस्थितास्मै Śi.7.38. See व्यवधान.
saṃvad संवद् 1 P. 1 To talk to, address; मैतस्मिन् संवदिष्ठा अतिष्ठाः Bṛi. Up.2.1.2. -2 To speak together, converse, discourse. -3 To resemble, tally with, correspond to, be like (with instr.); अस्य मुखं सीताया मुखचन्द्रेण संवदत्येव U.4; अहो संवदन्त्यक्षराणि Mu.5. -4 To name, call. -5 To agree, accord, consent. -6 To coincide, fit together (so as to give one sense). -Caus. 1 To consult, hold consultation (with instr.); as in मौहूर्तिकैः सह संवाद्यताम्. -2 To cause to sound, play upon (a musical instrument). -3 To declare (truly or sincerely); संवाद्य रूपसंख्यादीन् स्वामी तद्द्रव्यमर्हति Ms.8.31.
saṃvadanam संवदनम् ना 1 Conversing, talking together. -2 Communication of tidings. -3 Examination, consideration. -4 Subduing or overpowering by magic or charms. -5 A charm, an amulet. -6 A meaasge.
saṃvāvadūka संवावदूक a. Extremely similar, having a close resemblance; अचुम्बदस्याः स मुखेन्दुबिम्बं संवावदूकश्रियमम्बुजानाम् N.22.14.
sadaṃśavadanaḥ सदंशवदनः A heron.
samavadhānam समवधानम् 1 Great attention. -2 Preparation. -3 meeting.
saṃpravad संप्रवद् 1 U. 1 To speak loudly or distinctly (as men); संप्रवदन्ते ब्राह्मणाः Sk. -2 To cry, utter a cry (Paras.); (वरततु) संप्रवदन्ति कुक्कुटाः Mbh. -3 To converse together (Ātm.); शृण्वन् संप्रवदमानाद् रावणस्य गुणान् जनात् Bk.8.28.
saṃpravadanam संप्रवदनम् Conversation, dialogue.
sarvadamaḥ सर्वदमः = सर्वदमनः.
sarvadryañc सर्वद्र्यञ्च् a. Honouring or worshipping all.
sarvadā सर्वदा ind. At all times, always, for ever; सर्वदा सर्व- दो$सीति मिथ्या त्वं कथ्यसे बुधैः Bhojaprabandha 31.
sārvadhātuka सार्वधातुक a. (-की f.) Applicable to the whole of a radical term, or to the complete form of the verbal base after the conjugational characteristics have been affixed, i.e. to the four conjugational or special tenses. -कम् N. of the verbal terminations of the four conjugational tenses (strictly, the personal terminations of all tenses and moods except the Perfect and Benedictive and the affixes distinguished by a mute श्).
sāvadyam सावद्यम् (i. e. ऐश्वर्यम्) One of the three kinds of power attainable by an ascetic, (the other two being निरवद्य and सूक्ष्म). -a. Objectionable, blamable.
sāvadhāna सावधान a. 1 Attentive, bestowing attention, careful, heedful. -2 Cautious. -3 Diligent. -नम् ind. Carefully, attentively, cautiously.
sāvadhāraṇa सावधारण a. Limited, restricted.
sāvadhi सावधि a. Having a bound or limit, limited; finite, defined, circumscribed; सावधिस्तोयराशिस्ते यशोराशेस्तु नावधिः Subhāṣ.
sevadhi सेवधि See शेवधि under शेव.
sravadraṅgaḥ स्रवद्रङ्गः A fair, market.
svad स्वद् I. 1 Ā. (स्वदते, स्वदित) 1 To be liked, be sweet, be pleasant to the taste (with dat. of person); यज्ञदत्ताय स्वदते$पूपः Kāsikā; अपां हि तृप्ताय न वारिधारा स्वादुः सुगंधिः स्वदते तुषारा N.3.93; सस्वदे मुखसुरं प्रमदाभ्यः Śi.1. 23. -2 To taste, relish, eat. -3 To please. -4 To sweeten. -II. 1 U. or Caus. (स्वादयति-ते) 1 To cause to taste or eat. -2 To taste. -3 To sweeten.
svadanam स्वदनम् Tasting, eating.
svadita स्वदित p. p. Tasted, eaten. -तम् An exclamation meaning 'may it be well tasted or relished;, uttered at a Śhraddha ceremony after the presentation of riceballs or oblations of food to the Manes; पृष्ट्वा स्वदितमित्येवं तृप्तानाचामयेत्ततः Ms.3.251,254.
svadhā स्वधा [स्वद्-आ-पृषो˚ दस्य धः] 1 One's own nature or determination, spontaneity. -2 One's own will or pleasure. -3 The oblation of food offered to the Pitṛis or Manes of deceased ancestors; स्वधासंग्रहतत्पराः R.1.66; Ms.9.142; Y.1.12. -4 The food offered to the Manes personified. -5 Food or oblation in general. -6 One's own portion or share. -7 A Śrāddha or funeral ceremony; Ms.2.142. -8 N. of Māyā or illusion. ind. An exclamation uttered on offering an oblation to the Manes (with dat.); पितृभ्यः स्वधा Sk. -Comp. -कर a. offering oblations to the Pitṛis; यदपत्यं भवेदस्यां तन्मम स्यात् स्वधाकरम् Ms.9.127. -कारः the exclamation Svadhā; पूतं हि तद्गृहं यत्र स्वधाकारः प्रवर्तते. -निनयनम् a formula or sacred text used in making the oblations to the Pitṛis; नाभिव्याहारयेद्ब्रह्म स्वधानिनयनादृते Ms.2.172. -प्रियः 1 Agni or fire; -2 black sesamum. -भुज् m. 1 a deceased or defied ancestor. -2 a god, deity.
svadhitiḥ स्वधितिः m., f., -स्वधिती An axe; सूदा महानसं नीत्वा$- वद्यन्स्वधितिनाद्भुतम् Bhāg.1.55.5. -Comp. -हेतिकः a soldier armed with an axe.
svadhītiḥ स्वधीतिः A good reciter (of the Veda); a Brahmachārin; स्विष्टिः स्वधीतिः सुतपा लोकाञ्जयति यावतः Mb.12. 71.3.
Macdonell Vedic Search
10 results
vad vad speak, I. váda, ii. 33, 15; op. ii. 35, 15; vii. 103, 52; x. 34, 12. áchā- invoke, v. 83, 1. á̄- utter, ii. 12, 15; viii. 48, 14. prá- utter forth, iṣ ao., avādiṣur, vii. 103, 1. sám- converse about (acc.) with (inst.), vii. 86, 2.
vadant vád-ant, pr. pt. speaking, vii. 103, 3. 6. 7. [247]
avadya a-vadyá, n. blemish, x. 14, 8 [gdv. not to be praised, blameworthy].
tvad tvád, ab. (of tvám) than thee, ii. 33, 10.
mahāvadha mahá̄-vadha, a. (Bv.) having a mighty weapon, v. 83, 2.
viśvadānīm viśva-dá̄nīm, adv. always, iv. 50, 8.
viśvadeva viśvá-deva, a. [Bv.] belonging to all the gods, iv. 50, 6.
svadhā 1. svadhá̄, f. funeral offering, x. 14, 3. 7; 15, 3. 12-14.
svadhā 2. sva-dhá̄, f. own power, x. 129, 2; energy, x. 129, 5; vital force, ii. 35, 7; bliss, i. 154, 4 [svá ownand dhā put; cp. Gk. ἔ-θο-ς ‘custom’].
svadhāvant svadhá̄-vant, a. self-dependent, vii. 86, 4. 8.
Macdonell Search
99 results
vada a. speaking, m. speaker (--°ree;).
vadana n. speaking, talking; mouth; face; front, point (rare): -m kri, make a face (=grimace): -pa&ndot;kaga, n. lotus-face; -pav ana, m. breath; -mâruta, m. (wind coming from the mouth: vadana), breath.
vadanodara n. jaws.
vadānya va-dân-ya ] a. liberal, generous; m. liberal man: -tâ, f. liberality.
vadha m. vanquisher, slayer (V.); deadly weapon, esp. Indra's bolt (V.); slay ing, slaughter, murder, destruction (of or by, --°ree;); capital or (more commonly) corporal punishment (in law-books); annihilation (of things); prevention (rare): -ka, m. murderer; executioner; -karma½adhikârin, m. execu tioner; -kâma, a. desirous of killing; -kâm yâ, f. intention of striking or killing; -gîvin, a. living by the killing ofanimals, butcher; hunter.
vadhadaṇḍa m. corporal punish ment.
vadhanā f. deadly weapon (RV.).
vadhanigraha m. capital pun ishment; -bhûmi, f. place of execution.
vadhar n. missile, bolt, esp. of Indra (RV.).
vadharya den. only pr. pt. vadhar yántî, hurling the bolt = lightning cloud (RV.1).
vadhopāya m. means of corporal punishment.
vadhra m., î, f. leather thong or strap.
vadhri a. castrated, emasculate (V.).
vadhrikā f. thong, strap.
vadhrimatī f. a. having an im potent husband (RV.).
vadhū f. [√ vadh=√ vah: (to be) taken home], bride, young married woman, wife; woman; female of an animal; daugh ter-in-law, wife of a younger relative.
vadhu f. woman (rare).
vadhūjana m. women-folk; -tikâ, f. young woman (rare); -tî, f. id.; -tva, n. condition of a bride.
vadhūmat a. drawn by mares (RV.).
vadhūyu a. desiring women, wooing (RV.); -vara, n. sg. bride and bridegroom, newly-married couple; -vastra, n. bride's garment.
vadhyā f. (--°ree;) slaughter, murder.
vadhya fp. to be slain or killed; de serving or liable to be killed; sentenced to death; to be chastised or corporally pun ished; to be destroyed: -tâ, f. penalty of death or corporal punishment; -pataha, m.drum beaten at executions; -bhû, f. place of execution; -bhûmi, f. id.; -mâlâ, f. garland placed on the head of one sentenced to death; -silâ, f. stone used for executing or slaughter ing, block; -sthâna, n. place of execution; -srag, f.=-mâlâ.
vaditavya fp. to be spoken or said; -i-tri, m. speaker of (g.); a. speaking about (ac.).
vadya n. speech, discourse concerning (--°ree;).
akadvada a. not speaking ill, speaking well.
anavadhāna n. inattention, neg ligence.
anavadyāṅga a. (î) of faultless form.
anavadya fp. not unpraise worthy, blameless, faultless: -tâ, f., -tva, n. -ness; -rûpa, a. of faultless appearance.
anuṣvadham ad. willingly.
apriyaṃvada a. speaking un kindly, rude; -vâdin, a. id.
abhavadīya a. not belonging to your Honour.
abhivadana n. address; -vand ana, n. respectful salutation; -varnana, n. description; -vardhana, n. strengthening, increasing.
avadhvaṃsa m. dust; flour.
avadhra a. indestructible.
avadhya fp. inviolable: -vyavasâ ya-vâhya, a. foreign to the resolve that no thing should be killed; -tâ, f. inviolable ness; -tva, n., -bhâva, m. id.
avadhīrin a. surpassing (--°ree;).
avadhīraya den. P. refuse, dis dain, neglect; surpass. sam, disregard: pp. ita, disregarded, slighted, unheeded.
avadhīraṇa n., â, f. refusal; disdain.
avadhāna n. attention, devotion; -dhârana, n. affirmation; restriction; sin gling out: î-ya, fp. to be looked upon as settled; to be restricted to (in.); -dhârya, fp. to be ascertained; -dhí, m. limit;terminus ad quem; respite: --°ree;, ad. up to, till (g.).
avadha m. no murder; no beating.
avadya fp. blameworthy; n. fault; abuse; blame; disgrace.
avadāta pp. pure, white, clear: -tâ, f. whiteness; -dâna, n. heroic deed; -dâ ra, m. breach: -na, n. a. rending; bursting.
avyavadhāna n. non-interruption; a. uncovered, bare; uninterrupted; -dhâya-ka, a. not intervening: -tva, n. non intervention.
asvadharma n. neglect of duty.
asvadita pp. unpalatable.
avadola m. swinging, rocking.
ūvadhya n. contents of the entrails.
aurdhvadeha n. future life: i-ka, a. relating to the future life; n. obsequies; gifts distributed at obsequies.
karālavadana a. having a gaping or formidable mouth.
kuvadhū f. wicked woman; -vart man, n. wrong road, heresy.
avadāvada a. undisputed.
jīvadatta m. N.: -ka, m. id.; -dâya-ka, a. life-giving.
tāvaddhā ad. so many times.
tvadvidha a. like thee.
tvadīya a. thy, thine.
tvat tvát, tvad ab. and base (°ree;--) of tvam, thou.
devadatta a. god-given; m. Arguna's conch; the vital air which causes yawning; Dieu-donné, very common N., hence used to denote indefinite persons, So and-so; -dantin, m. ep. of Siva (?); -darsana, a. seeing or associating with the gods; m. N.; n. manifestation of a god; -darsin, a. associating with the gods; -dâru, m. n. N. of a kind of pine (Pinus Deodora); -dâsa, m. N.; -dûtá, m. messenger of the gods; -deva,m. god of gods, supreme god, ep. of Brahma, Siva, Vishnu, Krishna, and Ganesa: î, f. Durgâ; -daivatya, a. having the gods as a divinity, sacred or addressed to the gods.
daivadatta pp. bestowed by fate, innate; -durvipâka, m. ill-ripening dispensa tion=cruelty of fate; -para, a. to whom fate is the chief thing; m. fatalist; -parâyana, a. m. id.; -yoga, m. dispensation of fate; -vasa, m. will of fate: ab. accidentally; -vid, a. acquainted with fate; m. astrologer; -vi dhi, m. fate; -sampanna, pp. favoured by fortune: -tâ, f. abst. n.; -hata-ka, a. buf feted by fortune, unfortunate; accursed; n.accursed fate (Pr.).
navavadhū f. newly-married wo man.
navadhā ad. ninefold, nine times.
navadvāra n. pl. the nine gates (of the body); a. (náva-), nine-gated; n. body.
navadaśan a. pl. 19.
niravadhi a. boundless, unlimit ed; perpetual, endless: -ka, a. unlimited; -avayava, a. indivisible: -tva, n. -ness; -ava lamba, a. affording no support; unsupported, destitute of support; -avalambana,n. owner less (wealth); not to be met with in any one; -avasesha, a. leaving no remnant; complete, whole: in., -tas, altogether, wholly; -ava sâda, a. cheerful.
niravadya fp. blameless.
paraśvadha m. axe, hatchet.
paryavadhāraṇa n. mature re flexion; -½avasâna, n. conclusion, end; re sulting in (lc.); -½avasâyin, a. ending with, resulting in (--°ree;).
pūrvadakṣiṇa a. south-eastern; -datta, pp. previously given or presented; -dis, f. eastern quarter, east; -dishta, pp. determined by previous actions; -dîkshin, a. taking the first consecration (of two or more who sacrifice at the same time and place); -dugdha, pp. previously (milked=) drained or plundered; -drishtá, pp. seen before; formerly seen, ancient; looked upon of old or long regarded as (nm.); -deva, m.primaeval god; -devatâ, f. primaeval deity; -desa, m. eastern direction: lc. to the east of (ab.); eastern country; -deha, m. former body: lc.=in a previous existence.
priyaṃvada a. speaking kindly, affable to (g. or --°ree;); m. N.: â, f. N.; -vada ka, m. N.
bhagavadgīta n. song sung by the Adorable One (Krishna); â, f. pl. (± upanishad) secret doctrine sung by the Ador able One (Krishna), T. of a well-known theosophical poem forming an episode in the Mahâbhârata.
bhavadvirahanāma n. mere mention of separation from you.
bhavaduttaram ad. with &open;bha vat&close; at the end; -vakana, n. your speech; -vidha, a. one like you (in respectful address).
bhavadīya a. thine, your (in re spectful address).
bhavadanya a. other than you; -antya, a. having &open;bhavat&close; at the end; -âhâra½artham, ad. for your food.
mānavadeva m. god among men, king; -dharmasâstra, n. Manu's law-book; -pati, m. lord of men, king.
yāvadgamam ad. as fast as one can go; -grahanam, ad. till he has grasped or mastered it; -balam, ad. to the utmost of one's power; -râgyam, ad. for the whole reign; -vyâpti, ad. as far asanything extends.
yāvadantam ad. to the end; -abhîkshnam, ad. as long as a moment lasts; -artha, a. as much or many as required: °ree; or -m, ad.; -â-bhûta-samplavam, ad. till the destruction of created beings, till the end of the world; -âyusha-m, ad. as long as life lasts, for life; -âyus, ad. id.: h-pramâna, a. life-long; -ittham, ad. as much as neces sary; -îpsitam, ad. as much as one desires; -ukta, pp. as far as is stated: -m, ad.
yuvadrik ad. [n. abbreviated form of -ri½ak: √ ak] directed towards you two (RV.1).
vaśaṃvada a. (gnly. --°ree;) obedient to the will of, submissive, completely under the influence of, entirely dependent on, filled with, overcome by: -tva, n. complaisance.
vāvadūka (intv.) a. very eloquent; garrulous; disputatious.
vidhuvadanā f. moon-faced woman.
vaivadhika m. [=vivadhika] car rier (-tâ, f. abst. n.): î, f. female hawker.
vaiśvadeva a. (&isharp;) belonging, sacred etc. to all the gods or to the Visvedevas; n. a certain Sastra (Br., S.); a kind of Srâd dha, offering made by the householder morn ing and evening to the Visvedevas (C.): i-ka, a. belonging, sacred etc. to the Visvedevas; suitable for the Srâddha for all the gods.
śaśvadhā ad. ever again, for ever (RV.1).
śevadhi m. treasure; treasury (rare).
śyāvadant a. brown-toothed: -danta: -ka, a. id.; -danta-tâ, f. possession of brown teeth.
śvadṛti m. dog's bladder.
saṃvadana n. conversation, talk; -vánana, a. (î) V.: conciliating, propitiat ing; C.: encouraging (liberality, --°ree;); n. (V., C.) means of conciliation; subduing spell; -vara, m. n. incorr. for sambara;-várana, 1. m. N. (C.); n. enclosure (as place of sacri fice; V.); concealment, secrecy (C.); 2. n. (C.) choice (of a husband): -srag, f. wreath given by a girl to the man of her choice; -varanîya, fp. to be concealed; -vargá,a. √ vrig] rapacious (Agni; V.); -várgam, abs. snatching up, sweeping together (RV.); -varta, m. [rolling together: √ vrit] dense mass (of people); cloud charged with rain; end or dissolution of the world; N. (C.;á, RV.1): -ka, a. (rolling together), destroying all things at the end of the world (fire etc.); m. fire of universal destruction: pl. fires of hell; -vartikâ, f. (rolled up leaf=) young lotus petal; -vardhana, a. increasing, pro moting; m. N.; n. growing up (of a child); rearing (of a child); success; promoting; -vardhanîya, fp. to be reared (child); to be maintained (servants); to be increased or fos tered (virtue); -valana, n., â, f. (hostile) en counter; mixture, union; -vasati, f. dwell ing together; -vásana, n. dwelling-place (RV.1); (sám)-vasu, m. fellow-dweller (V.); -vaha, m. N. of one of the seven winds; -v&asharp;k, f. colloquy (V.); -vâdá, m. conversation (V., C.), with (in. ± saha, lc., --°ree;); agreement, conformity, correspondence, similarity, equal ity (C.): (a)-ka, a. agreeing; m. N.; -vâd ana, n. agreement; -vâdin, a. conversing; agreeing or harmonizing, with (g., --°ree;); -vâ ra, m. contraction of the vocal chords (in pronouncing a sound), obtuse articulation (opp. vivâra); impediment (v. r.); -vârya, fp. to be concealed; -vâsa, m. dwelling to gether, with (in. ± saha, --°ree;); cohabitation, with (--°ree;); settlement, dwelling; common abode (rare); -vâsin, a. 1. clothed in (--°ree;); 2. dwelling together; --°ree;, dwelling in, inha biting; m. fellow-dweller; -vâha, m. ex tortion, oppression: -ka, a.stroking (--°ree;); m., i-kâ, f. shampooer; -vâhana, n. passage (of clouds); stroking with the hand (±hasta-, of limbs etc., --°ree;); -vâhya, fp. to be borne; to be exhibited (in a-).
sarvadeva m. pl. all the gods; -devatâ-maya, a. (î) containing all deities; -devatyã, a. sacred to or representing all the gods; -deva-maya, a. (î) containing or representing all gods; -desîya, a. coming from every country; -daivatya, a. representing all gods; -dravya, n. pl. all things; -dhar ma-maya, a. containing --, -vid, a. knowing all laws; -nara, m. every one; -nâma-tva, n. pronominal nature; -nâman, n. (general name), pronoun; -nâma-sthâna, n. case termination added to the strong base; -nâsa, m. complete lack; loss of everything, com plete ruin: -m kri, lose everything; -niyan tri, m. all-subduer: -tva, n. abst. n.; -patta maya,a. made of fabrics of all kinds; -path îna, a. occupying the whole road; -prabhu, m. lord of all; -prâna, m.: in. with all one's might; -prâyaskittá, a. (&isharp;) atoning for every thing (Br.); n. (V.) expiation for everything; a certain libation in the Âhavanîya; -prâ yaskitti, f. complete atonement; -bhaksha, a. eating or devouring everything, omnivor ous; -bhakshin, a. id.; -bhâva, m. whole heart or soul; complete satisfaction:in., °ree;--, with one's whole soul (love etc.): pl. all ob jects; -bhûta, pp. being everywhere; n. pl. °ree;--, all beings: with na, no being: -krit, a. framing all beings, -maya, a. (î) containing or representing all beings, -½âtman, m. soul of all beings; -bhûmi, a. owning the whole earth; -bhogya, fp. advantageous to all; -ma&ndot;gala, a. universally auspicious: â, f. ep. of Durgâ (sts. also of Lakshmî); -manorama, a. delighting every one; -máya, a. (î) con taining everything; -mahat, a. greatest of all: -tara, cpv. greater than all the rest; -mâmsa½ada, a. eating every kind of flesh; -mâya, m. N. of a Râkshasa; -medhá, m. universal offering (a ten days' Soma sacrifice); -medhya-tva, n. universal purity; -yagña, m. every sacrifice: pl. all sacrifices; -yatna, m. every effort: in. with all one's might, to the best of one's ability; -yatna- vat, a. making every possible effort; -yoni, f. source of all; -yoshit, f. pl. all women; -ratna, m. N.: -maya, a. formed of all gems; entirely studded with jewels, -samanvita, pp. possessed of all jewels; -rasa, m. all kinds of juices or fluids (pl. or °ree;--); every taste: pl. all kinds of palatable food; -râtra, m. (?) the whole night: °ree;-or -m, ad. the whole night through; (sárva- AV., or sarvá- SB.)-rûpa, a. (V.) having all colours; having or assum ing all forms; of all kinds; -½ritu-ka, a. habitable in every season (house); -li&ndot;ga, a. having all genders, adjectival; -loká, m. V., C.: the whole world; C.: the whole people; every one: pl. or °ree;--, all beings; every one: -bhayamkara, a. appalling to the whole world, -mahesvara, m. ep. of Siva and of Krishna; -loha, a. entirely red; n. metals of all kinds (°ree;--): -maya, a. (î) entirely of iron; -vâram, ad. all at once, simultaneously; -vikrayin, a. selling all kinds of things; -vigñân-in, a. knowing everything: (-i)-tâ, f. omniscience; -víd, a. omniscient; -vinâsa, m. entire destruction; -vinda, m. a certain mythical being; -vishaya, a. relating to everything, general; (sárva)-vîra, a. all-heroic, consisting of, relating to, accompanied by or leading all men or heroes (V.); -ved asá, a. attended by a gift of all one's goods (sacrifice; V.); bestowing all his property on priests after a sacrifice (C., rare); n. en tire property (V.): -dakshina, a. attended with a gift of all one's property as a sacrificial fee (sacrifice; V., C.); -vedin, a. omniscient; knowing all the Vedas; -vainâsika, a. be lieving in complete annihilation; m. Bud dhist; -vyâpad, f. complete failure; -vyâp in, a. all-pervading; -vrata, n. universal vow; a. all-vowing; -sakti, f. entire strength: in. with all one's might; -sa&ndot;kâ, f. suspicion of every one.
sarvadā ad. at all times, always, for ever: with na, never.
sarvada a. all-bestowing; -damana, a. all-subduing; m. ep. of Bharata, son of Sakuntalâ; N. of an Asura; -darsin, a. all-seeing; -dâna, n. gift of one's all.
sārvadhātuka a. applying to the whole root (i. e. the extended verbal root of the present base); -bhautika, a. affecting all beings; -bhaumá, a. [sarva-bhûmi] re lating to, prevailing or ruling over the whole earth; m. universal monarch, emperor; N. of the elephant of the northern quarter, vehicle of Kubera; -laukika, a. (î) known to or prevailing throughout the whole world, universal, general; permitted to every one; -varn-ika, a. of every kind; belonging or common to all the castes; -vedasa, n. entire property: -dakshina, a. attended with the bestowal of one's entire property as a fee (sacrifice); -½âyusha, a. having entire vital ity, thoroughly vigorous (Br.).
svadeśa m. one's own country, home: -ga, a. born in one's own country; m. com patriot, -smârin, a. yearning for one's own country, home-sick; -deha-dâna, n. gift of one's own body; -dosha-ga, a.due to one's own fault (misfortune); -dosha-nâsa, m. avoidance of personal guilt; -dharma, m. one's rights; one's own duty.
svadhvara a. performing the sacri fice well, adapted to the rite (RV.); n. good sacrifice (RV.).
svadhṛti f. standing still of oneself (V.).
svadhiṣṭhita pp. well-guided (elephant); -½adhîta, pp. well-read, well-instructed; n. good studies.
svadhiti f. axe, (butcher's) knife (V., very rarely P.).
svadhāvat V. a. adhering to law, regular, constant, faithful (gnly. of Agni and Indra); (â)-van, a. id. (V.).
svadhā f. [cp. sudhâ] sweet libation, oblation to the Manes (consisting of ghee); attenuated to a mere exclamation addressed to the Manes (d., g.), taking the place of or accompanying the offering: -kara, a. addressing the Manes with the exclamation svadhâ; -kârá, m. exclamation svadhâ; -ninayana, n. oblation with the exclamation svadhâ; -bhug, m. pl. (enjoying the funeral oblation), Manes.
svadhā f. [self-determination: √ dhâ] V.: custom, rule, law; accustomed place, home; (wonted state), ease, pleasure: ac. w. ánu, according to wont; at ease or pleasure, as desired; undisturbed: in. svadháya or svadh&asharp;bhih, in one's own way, according to wont; gladly; at will, freely, spontaneously; wantonly.
Vedic Index of
Names and Subjects
99 results18 results
vadhaka Is the name of some sort of ‘reed’ in the Atharva­veda and the Satapatha Brāhmaṇa.
vadhar Means a ‘weapon’ generally; it is used not merely of a divine, but also of a human weapon in the Rigveda.
vadhrimatī ‘Having an impotent man as a husband,’ seems in the Rigveda to be the name of a woman who owed the restoration of her husband’s virility to the Aśvins, and obtained a son, Hiraṇyahasta. The word is, however, possibly only descriptive.
vadhryaśva ‘Having castrated horses,’ is the name in the Rigveda1 of a prince, the father of Divodāsa, and an energetic supporter of the fire cult, as was his son after him. He is mentioned in a long list of names in the Atharvaveda.
vadhryaśva ánūpa (‘Descendant of Anūpa’) is the name of the seer of a Sāman, or chant, in the Pañcavimśa Brāhmaṇa.
vadhū Is a frequent word for ‘woman’ in the Rigveda and later. It denotes, according to Delbriick, the woman as either married or as seeking a husband, or as a bride in the wedding ceremony. The word appears to be derived from a form of the root vah, ‘ to carry,’ as is vahatu, ‘ the bridal pro­cession,’ thus meaning ‘ she who is to be or has been conducted home.’ Zimmer, however, objects to this explanation, regarding vadhū as a derivative from a different root meaning 'to marry.’
vadhū Is in one passage of the Rigveda taken by Roth to denote a ‘ female animal,’ while Zimmer urges that it means a ‘ female slave.’ As far as the use of Vadhū goes, either meaning is abnormal, for if Vadhū never elsewhere means a female animal (from vah, to draw ’ a cart), neither does it denote a slave: as the passage refers to a gift of fifty Vadhūs by Trasadasyu Paurukutsya to the singer, the latter must have been a polygamist of an advanced type to require fifty wives. The same doubt arises in the case of vadhūmant, which is used in the Rigveda and Atharvaveda as an epithet of the chariot (Ratha), of horses (Aśva), and of buffaloes (Uçtra). Zimmer sees in all cases a reference to slaves in the chariots or with the horses: this interpretation has the support of the Brhaddevatā. Roth’s version of the references to horses or buffaloes as suitable for draught ’ is not very happy ; if vadhū is really a female animal vadhūmant means rather ‘ together with mares,’ or together with female buffaloes,’ which makes reasonable sense.
avadhyatā See Brāhmanṇa
aśvadāvan Ludwig finds a prince of this name in a passage of the Rigveda, where a gift of fifty horses is mentioned, but the word appears to be an epithet of Indra (‘ bestower of horses ’).
evāvada Is regarded by Ludwig in a very obscure passage of the Rigveda as the name of a singer beside Ksatra, Manasa, and Yajata. The commentator Sāyana also interprets the word as a proper name. Roth, however, considers it to be an adjective meaning ‘ truthful.' Translation of the Rigveda,
brahmavadya See Brahmodya.
mātṛvadha ‘Matricide,’ is mentioned as a very grave crime in the Kausītaki Upanisad, but as one that can be expiated by the knowledge of the truth.
vivadha Seems to denote a yoke borne on the shoulders to enable one to carry a weight. But it is found in the Brāhmaṇas used only metaphorically in such phrases as vi-vivadha, ‘with the weight unequally distributed,’ and sa- vīvadhata, ‘equality of burden.’
śarvadatta (‘Given by the god śarva’) Gārgya (‘descendant of Garga ’) is the name of a teacher in the Vamśa Brāhmana.
śevadhi Denotes 'treasure' in the Rigveda and later.
saptavadhri Is the name of a protágá of the Aśvins, who appear from several passages of the Rigveda to have rescued him from a tree in which he had got fastened. He is men­tioned in the Atharvaveda. According to Geldner, he is identical with Atri.
svadhiti In the Rigveda denotes the ‘axe’ or ‘knife’ used for dissecting the sacrificial horse. In all the other passages in that Saṃhitā the sense of 'axe' for cutting wood is adequate; reference is made in one place to sharpening the axe on the whetstone (ksnotra). In the Atharvaveda the term seems once to denote the copper (lohita) knife used to mark the ears of cattle; the carpenter’s knife or axe is also twice referred to there.® Later the word means ‘axe’ generally. As a weapon it does not appear at all.
svadhiti In certain passages of the Rigveda denotes, according to the St. Petersburg Dictionary, a great tree with hard wood. This interpretation seems probable.
Bloomfield Vedic
Concordance
99 results18 results1548 results
achā vada tavasaṃ gīrbhir ābhiḥ RV.5.83.1a; TB.2.4.5.5a; Aś.2.13.9; Apś.8.1.4a. Cf. BṛhD.5.88; Rvidh.2.17.4.
achā vadā tanā girā RV.1.38.13a.
achā vadāmi jīvalām AVś.6.59.3b.
achāvāka vadasva (Mś. vada) Aś.5.7.2; śś.7.6.1; Mś.2.4.1.49. See next.
achāvāka vadasva yat te vādyam AB.6.14.8; KB.28.5; śB.4.3.1.1; Kś.9.12.10; Apś.12.26.2. See prec.
adharo vad asau vadā svāhā HG.1.15.5d. See prec., and cf. adho vadādharo.
adhivastrā vadhūr iva RV.8.26.13b.
adho vadādharo vada HG.1.15.6a. Cf. adharo vad asau.
ahaṃ vadāmi net (AVP. vadāni mā) tvam AVś.7.38.4a; AVP.3.29.5a.
āṇyor vadhrān uta koṣaghorā AVP.15.12.7c.
apaskandya vadhed ahim AVP.2.70.1b.
asurakṣayaṇaṃ vadham AVś.11.10.10c,12e,13c.
asyā vadhvā agnisakāśam āgachantyāḥ MG.1.11.9b.
avye vadhūyuḥ pavate pari tvaci RV.9.69.3a.
bhadrā vadhūr bhavati yat supeśāḥ RV.10.27.12c.
bhadraṃ vada gṛheṣu ca RVKh.2.43.2b; Kauś.46.54b.
bhadraṃ vada dakṣiṇataḥ RVKh.2.43.1a; Kauś.46.54a; N.9.5a.
bhadraṃ vada putraiḥ RVKh.2.43.2a; Kauś.46.54a.
bhayeḍako vadati vācam etām TA.4.31.1b; HG.1.17.1b.
bhūtaṃ vadiṣye TA.4.1.1.
bhuvanaṃ vadiṣye TA.4.1.1.
brahma vadiṣye (VārG. vadiṣyāmi) TA.4.1.1; VārG.8.4.
bṛhad vadanti madireṇa mandinā RV.10.94.4a; KB.29.1. P: bṛhad vadanti śś.7.15.11.
bṛhad vadema vidathe suvīrāḥ RV.2.1.16d; 2.13d; 11.21d; 13.13d; 14.12d; 15.10d; 16.9d; 17.9d; 18.9d; 19.9d; 20.9d; 23.19d; 24.16d; 27.17d; 28.11d; 29.7d; 33.15d; 35.15d; 39.8d; 40.6d; 42.3d; 43.3d; 9.86.48d; AVś.18.3.24d; VS.34.58d; MS.4.12.1d: 178.8; 4.14.1d: 215.6; KB.8.5; TB.2.8.1.6d; 5.1d; 6.9d; TA.10.39.1d; MahānU.16.4d; śś.5.9.19; Kauś.46.54d; N.1.7d.
cāru vadāni pitaraḥ saṃgateṣu AVś.7.12.1d.
codayan vadhriṇā yujā RV.10.102.12d.
dakṣasya vādite janmani vrate RV.10.64.5a; N.11.23a. Cf. BṛhD.7.104.
digbhyo vaḍabe (KSA. vaḍave) TS.5.6.21.1; KSA.10.1.
divodāsaṃ vadhryaśvāya dāśuṣe RV.6.61.1b; MS.4.14.7b: 226.4; KS.4.16b.
dṛḍhā vadann anamasyur namasvinaḥ RV.10.48.6d.
dyumad vadata TS.1.1.5.2; TB.3.2.5.9.
dyumad vada dundubhe sūnṛtāvat AVś.5.20.6d; AVP.9.27.6d.
ete vadanti śatavat sahasravat RV.10.94.2a.
ete vadanty avidann anā madhu RV.10.94.3a.
giriśāchā vadāmasi VS.16.4b; TS.4.5.1.2b; MS.2.9.2b: 121.3; KS.17.11b; NīlarU.6b. See girīśāchā.
girīśāchā vadāmasi AVP.14.3.6b. See giriśāchā.
grāvā vadann apa rakṣāṃsi sedhatu RV.10.36.4a.
indrāvaruṇā vadhanābhir aprati RV.7.83.4a.
indrote vadhūmataḥ RV.8.68.17b.
itthā vadadbhir valam aṅgirobhiḥ RV.6.18.5b.
jahi vadhar vanuṣo martyasya RV.4.22.9d; 7.25.3c.
jaitrāyāchā vadāmasi AVP.5.1.6d; 7.12.1d.
jāmir vadharyuḥ pratimānimīta AVP.6.2.4d. Cf. jāmyai dhuryaṃ.
jihvayā vadata priyam AVP.9.4.4d.
joṣavākaṃ vadataḥ pajrahoṣiṇā RV.6.59.4c; N.5.22c.
kiṃtvo vadati kiṃtvaḥ VS.20.28d.
kṛṇomi vadhri viṣkandham AVś.3.9.2c; AVP.3.7.3c.
madhu vadiṣyāmi TS.3.3.2.2; TA.4.1.1.
mahimānaṃ vādhryaśva pra vocan RV.10.69.9b.
mantraṃ vadaty ukthyam (NṛpU. uktham) RV.1.40.5b; VS.34.57b; MS.1.6.2b: 88.15; KS.7.14b; ā.1.2.1.6b; Apś.5.19.3b; NṛpU.2.4b.
marto vadhāya dāśati RV.6.16.31b.
mota vadhī raśmibhiḥ sūryasya AVś.7.11.1d.
mṛdukaṃ vādayiṣyati Lś.4.2.8b.
nanamo vadhar adevasya pīyoḥ RV.1.174.8d; 2.19.7d.
nirṛtyā vadhyatāṃ pāśe AVP.10.12.8c.
nṛvad vadann upa no māhi vājān RV.10.28.12c.
parā vada dviṣato vādyam Lś.3.11.3a.
parā vada dviṣantaṃ ghorāṃ vācaṃ parā vadāthāsmabhyaṃ sumitryāṃ vācaṃ dundubhe kalyāṇīṃ kīrtim ā vada Lś.3.11.3. Quasi metrical.
paro vadāty avareṇa pitrā RV.6.9.2d.
patir vadati jāyayā AVś.20.127.8d; śś.12.17.1.2d.
pauruṣeyo vadhaḥ prahetiḥ VS.15.15; TS.4.4.3.1; MS.2.8.10: 114.18; KS.17.9; śB.8.6.1.16.
pitṛbhyāṃ vadati priyam AVP.9.4.4b.
pra vadantu vīṇāḥ Lś.4.1.11. Cf. under gāyatam.
praite vadantu pra vayaṃ vadāma RV.10.94.1a; KB.29.1; N.9.9a. P: praite vadantu Aś.5.12.9; śś.7.15.4,5,6,9,10. Cf. BṛhD.7.146. Designated as arbuda KB.15.1; Aś.5.12.9,23; śś.7.15.4--6 ff.; PB.4.9.5.
ṛtā vadantaś camasāṃ apiṃśata RV.1.161.9d.
ṛtā vadanto anṛtaṃ rapema RV.10.10.4b. See ṛtaṃ etc.
ṛtaṃ vadanta ṛtayuktim agman RV.10.61.10b.
ṛtaṃ vadantāv ṛtodyeṣu AVś.14.1.31b.
ṛtaṃ vadanto anṛtaṃ rapema AVś.18.1.4b. See ṛtā etc.
ṛtaṃ vadann ṛtadyumna RV.9.113.4a.
ṛtaṃ vadiṣyāmi TA.7.1.1; TU.1.1.1; śG.6.4.7; MG.1.4.4; VārG.8.4.
tā vadanti yathāyatham AVś.10.8.33b.
taṃ vadheyaṃ taṃ stṛṣīyānena brahmaṇānena karmaṇānayā menyā AVś.10.5.15--21.
taṃ vadhai stṛṇavāmahai AVś.10.5.42b.
tapo vadiṣye TA.4.1.1.
tasmin vadema sumatiṃ svasti AVś.10.6.35c.
tejo vadiṣye TA.4.1.1.
trasadasyur vadhūnām RV.8.19.36b.
tvayā vadheyaṃ dviṣataḥ sapatnān Vait.6.1c.
urasto vadvadān ghorān SMB.2.5.3c.
yad vadāmi madhumat tad vadāmi AVś.12.1.58a. P: yad vadāmi Kauś.24.14; 38.29.
yad vādāsyan saṃjagārā janebhyaḥ TB.3.7.12.3b. See under adāsyann.
yad vādo rocane divaḥ RV.8.10.1b. Cf. yad vāsi rocane.
yad vādya satyam uta yan na vidma TA.4.11.7c. See yad vā ghā satyam.
yaśo vadiṣye TA.4.1.1.
yasyāṃ vadati dundubhiḥ AVś.12.1.41d.
yatrā vadete avaraḥ paraś ca RV.10.88.17a; N.7.30a.
yayor vadhān nāpapadyate kaś (AVP. kiṃ) cana AVś.4.28.5a; AVP.4.37.3a, 5.22.3a.
aṃśūn iva grāvādhiṣavaṇe adriḥ # AVś.5.20.10c; AVP.9.27.10c.
akrandayo nadyo roruvad vanā # RV.1.54.1c.
akṣīyamāṇā svadhayā madanti # RV.1.154.4b.
agdhād eko 'hutād ekaḥ samasanād ekaḥ # TS.3.3.8.2b. See adhvād eko.
agnaye kavyavāhanāya svadhā namaḥ (JG. adds svāhā) # AVś.18.4.71; TB.1.3.10.3; Aś.2.6.12; Apś.1.8.4; Mś.1.1.2.18; 11.9.1.7; MG.2.9.13; JG.2.1; ViDh.21.7. P: agnaye kavyavāhanāya Vait.9.8; Kauś.88.2.
agnaye kavyavāhanāya svadhā svāhā # ApMB.2.19.13 (ApG.8.21.4); ApMB.2.21.9 (ApG.8.22.7).
agnaye kavyavāhanāya sviṣṭakṛte svadhā namaḥ # HG.2.11.3; 14.6; 15.10; BDh.2.8.14.7.
agnaye vaiśvānarāya dvādaśakapālaḥ # VS.29.60; TS.7.5.14.1; 22.1; KS.21.10; KSA.5.10,19. Cf. vaiśvānaraṃ dvādaśakapālam.
agnaye vaiśvānarāya dvādaśakapālo mṛgākhare yadi nāgachet # TS.7.5.21.1; KSA.5.18.
agniṃ hotāraṃ manuṣaḥ svadhvaram # RV.6.15.4b.
agniṃ kṛte svadhvare # RV.5.17.1c.
agnināgniḥ saṃvadatām # TA.4.34.1f. Cf. agne agninā.
agninā havyā svaditāni vakṣat # VS.29.10d; TS.5.1.11.4d; MS.3.16.2d: 185.1; KSA.6.2d.
agniṃ toke tanaye śaśvad īmahe # RV.8.71.13c.
agniṃ purīṣyam aṅgirasvad achemaḥ # VS.11.16; TS.4.1.2.2; 5.1.2.4; MS.2.7.2: 75.8; 3.1.3: 4.13; KS.16.1; 19.2; śB.6.3.3.3; Mś.6.1.1.12; Apś.16.2.6. P: agniṃ purīṣyam Kś.16.2.11. Cf. agneḥ purīṣam etc.
agniṃ purīṣyam aṅgirasvad achehi # Apś.16.2.5. Cf. pṛthivyāḥ sadhasthād agniṃ etc.
agniṃ purīṣyam aṅgirasvad ābhara # MS.2.7.2: 75.8; 3.1.3: 4.11; Mś.6.1.1.11. Cf. pṛthivyāḥ sadhasthād agniṃ etc.
agniṃ purīṣyam aṅgirasvad bharāmaḥ # VS.11.47; TS.4.1.2.2; 5.1.2.5; MS.2.7.4: 79.9; KS.16.1; śB.6.4.4.14; Apś.16.3.13. P: agniṃ purīṣyam Kś.16.3.13.
agniṃ purīṣyam aṅgirasvad bhariṣyāmaḥ # VS.11.16; TS.4.1.2.2; 5.1.2.5; MS.2.7.2: 75.9; 3.1.3: 4.15; KS.16.1; śB.6.3.3.4; Apś.16.2.7; Mś.6.1.1.13. P: agniṃ purīṣyam Kś.16.2.13.
agnir amṛto abhavad vayobhiḥ (KS. sahobhiḥ) # RV.10.45.8c; VS.12.1c,25c; TS.1.3.14.5c; 4.1.10.4c; 2.2.4c; KS.16.8c,9c; śB.6.7.2.2; ApMB.2.11.31c. See agnir ajaro.
agnir ācāryas tava (AG. tavāsau) # śB.11.5.4.2; AG.1.20.6; śG.2.3.1b; PG.2.2.20; HG.1.5.10c; ApMB.2.3.12 (ApG.4.10.12); JG.1.12; MG.1.22.5 (preceded by asāv); VāDh.7.6.
agnir ait pradahan viśvadāvyaḥ # AVś.10.8.39b.
agnir jātavedā iha śravad iha somasya matsat # śś.8.24.1. Cf. agnir vaiśvānara iha.
agnir dūto abhavad dhavyavāhanaḥ # RV.5.11.4c.
agnir devo daivyo (omitted in Apś.) hotā devān yakṣad vidvāṃś cikitvān manuṣvad bharatavad amuvad amuvat (śB. omits amuvad amuvat) # śB.1.5.1.5--11; Kś.3.2.7; Apś.2.16.5; Mś.1.3.1.26.
agnir naḥ (VSK. mā) pātu duritād avadyāt # VS.4.15e; VSK.4.5.7e; śB.3.2.2.23e. See apa bādhatāṃ, and cf. pātu no duritād.
agnir bhuvad rayipatī rayīṇām # RV.1.60.4d; 72.1c; TS.2.2.12.2c.
agnir vanaspatir indro vasumān rudravān ādityavān ṛbhumān vibhumān vājavān bṛhaspatimān viśvadevyāvān somas tam apanudantu # Kś.10.7.14. Cf. agner vanaspater etc.
agnir viśvād vasumān svastaye # AVP.2.85.2d.
agnir vaiśvānara iha śravad iha somasya matsat # śś.8.22.1. Cf. next but one, and agnir jātavedā iha.
agnir haviḥ (so RV.KS.; the rest havyaṃ) śamitā sūdayāti (AVś. svadayatu) # RV.3.4.10b; 7.2.10b; AVś.5.27.11c; AVP.9.1.10c; VS.27.21c; TS.4.1.8.3c; MS.2.12.6c: 150.19; KS.18.17b. Cf. agnir havyāni, and agnir havyā suṣūdati.
agnir havyavāḍ iha tān āvahatu # TB.3.7.4.4c; Apś.4.1.8c.
agnir havyāni siṣvadat # RV.1.188.10c. Cf. under agnir haviḥ śamitā.
agniś ca mā manyuś ca manyupatayaś ca manyukṛtebhyaḥ pāpebhyo rakṣantām # TA.10.24.1; MahānU.14.3. P: agniś ca mā manyuś ca VāDh.23.23.
agniḥ śardham anavadyaṃ yuvānam # RV.1.71.8c; VS.33.11c; TS.1.3.14.6c; MS.4.4.15c: 240.8.
agniṣ ṭad viśvād agadaṃ (TA. anṛṇaṃ) kṛṇotu # RV.10.16.6c; AVś.18.3.55c; AVP.2.28.1d--4d; TA.6.4.2c.
agnihotraṃ vaiśvadevī duhānā # AVP.6.10.2b.
agnīṣomāv adadhur yā turīyāsīt # AVś.8.9.14a. See catuṣṭomo abhavad.
agne agninā saṃvadasva # TA.4.28.1; Apś.15.19.2; HG.1.16.20. Cf. agnināgniḥ saṃvadatām.
agne achā vadeha naḥ # RV.10.141.1a; AVś.3.20.2a; AVP.3.34.3a; VS.9.28a; TS.1.7.10.2a; MS.1.11.4a: 164.6; KS.14.2a; śB.5.2.2.10a; Mś.6.2.5.28; 7.1.3.19. Ps: agne achā vada Rvidh.4.10.1; agne achā Vait.29.19. Cf. BṛhD.8.53.
agneḥ pūrvadiśyasya sthāne svatejasā bhāni # TA.1.18.1.
agne ko dāśvadhvaraḥ # RV.1.75.3b; SV.2.885b.
agne carur yajñiyas tvādhy arukṣat # AVś.11.1.16a; Kauś.2.7. P: agne caruḥ Kauś.61.31.
agne cyavasva sam anu prayāhi # MS.2.12.4a: 148.1. See samācinuṣvānu, and saṃ pra cyavadhvam.
agne jāyasvāditir nāthiteyam # AVś.11.1.1a. P: agne jāyasva Kauś.60.19.
agne dyumad uta revad didīhi # RV.2.9.6d; TS.4.3.13.2d; 6.1.5d; MS.4.10.5d: 154.5; KS.21.13d.
agne pūṣan bṛhaspate pra ca vada pra ca yaja # śB.1.5.1.16. See indra pūṣan.
agne manuṣvad aṅgiraḥ # RV.5.21.1c; KS.2.9c; 7.13c; 39.13c; TB.3.11.6.3c; Apś.7.7.1c; 16.35.5c; Mś.1.7.3.43c.
agne rayiṃ maghavadbhyaś ca dhehi # RV.6.10.5b.
agne rayiṃ maghavadbhyo na ā vaha # RV.7.16.9c.
agner vanaspater indrasya vasumato rudravato ādityavata ṛbhumato vibhumato vājavato bṛhaspatimato viśvadevyāvataḥ somasyojjitim # Kś.10.7.14. Cf. agnir vanaspatir etc.
agne vahne svaditaṃ nas tanaye pituṃ paca # Apś.4.16.5.
agne vivasvad ā bhara # SV.1.10a.
agne vivasvad uṣasaḥ # RV.1.44.1a; SV.1.40a; 2.1130a; JB.1.349; PB.9.3.4; Aś.4.13.7; 6.6.8; 9.9.9; Apś.14.23.15; Svidh.3.3.2; VHDh.8.54. P: agne vivasvat śś.6.4.7; 14.55.3; 15.3.3. Fragments: agne, uṣasaḥ JB.1.349. Cf. BṛhD.3.111.
agne vratapate vrataṃ cariṣyāmi # VS.1.5; TS.1.5.10.3; 6.7.2; MS.4.9.24: 137.8; śB.1.1.1.2; TB.3.7.4.7; TA.4.41.3; śś.4.8.3; Apś.4.3.2; 15.20.3; Kauś.56.6; SMB.1.6.9; HG.1.7.8; JG.1.12. P: agne vratapate Kś.2.1.11; Mś.4.7.4; GG.2.10.16; KhG.2.4.7; JG.1.12. Cf. VāDh.28.13. See next but one.
agne svadhvarā kṛṇu # RV.3.29.12c.
aghamarṣaṇam (sc. sūktam), designation of the hymn # RV.10.190 (ṛtaṃ ca satyaṃ cābhīddhāt); HG.2.18.9; GDh.19.12; 24.10,12; BDh.2.5.8.11; 10.17.37; 3.4.5; 5.2; 10.10; 4.2.7,15; 3.8; 4.2; ViDh.22.10,63; 46.5; 51.25; 55.4,7; 56.3; 64.19; VāDh.22.9; 23.19,23; 26.8; 28.11; MDh.11.260; YDh.3.302; LAtDh.2.8; 3.11; and p. 6, l. 7; VAtDh.2.8; 3.11; and p. 52 (bis), lines 12 and 13; LHDh.4.32; VHDh.4.30; 7.74; 8.7; Rvidh.4.23.5; Karmap.2.1.9; BṛhPDh.2.54,55; LVyāsaDh.2.21,25; śaṅkhaDh.8.10,13; 10.2; 11.1; 18.1,2; Mahābh.3.263.29.
aghāśvāya śaśvad it svasti # RV.1.116.6b.
aṅgāny upāvadhīr aṅgāni tvā hāsyanti # Apś.10.2.11.
aṅguṣṭhamātraḥ puruṣaḥ # TA.10.38.1a; MahānU.16.3a; BDh.2.7.12.11a. See Jacob's Concordance to the Upaniṣads, s.v. aṅguṣṭhamātra. Designated as madhūni, GDh.19.12; VāDh.22.9; BDh.3.10.10.
aṅgoṣṭhyā stotryā jīvadhanyāḥ # AVP.6.3.12b.
acakrayā yat svadhayā suparṇaḥ # RV.4.26.4c.
acakrayā svadhayā vartamānam # RV.10.27.19b.
acyutam akṣitaṃ viśvadānīm # AVP.5.40.4a.
achā ca tvainā namasā vadāmasi # RV.8.21.6a.
achā devaṃ vadāmasi # AVP.2.55.1d.
achā bṛhadvadāṃ vada # AVP.7.12.7c.
achāvāko 'bhavad yaśaḥ # TB.3.12.9.4b.
achā svadhvaraṃ janam # RV.8.5.33c.
ajarāmṛtā carati svadhābhiḥ # RV.1.113.13d.
ajījano hi varuṇa svadhāvan # AVś.5.11.11c; AVP.8.1.11a.
aṇau muṣkā upāvadhīt # AVś.20.136.2b; śś.12.24.2.3b.
atakṣan dhenum abhavad viśvarūpī # śś.8.20.1.
ati viśvaṃ vavakṣitha # RV.1.81.5e; SV.1.312d. See anu svadhāṃ vavakṣitha.
ato 'dhi te kṛṇavad bhāgadheyam # AVś.6.111.1c; AVP.5.17.6c.
ato matīr (SV. matiṃ) janayata svadhābhiḥ # RV.9.95.1d; SV.1.530d.
atriṇā tvā krime hanmi # TA.4.36.1a; Apś.15.19.5. See atrivat, atrivad, and hatas te atriṇā.
atraiva tvā krime brahmavadyam avadya # SMB.2.7.1d.
atha jivrir vidatham ā vadāsi # AVś.8.1.6d; 14.1.21d. See athā jīvrī, and adhā jivrī.
atha jīvāso vidatham ā vadema # AVś.12.2.30d. Cf. yathā jīvo.
atharvāṇaṃ pitaraṃ devabandhum (AVP. viśvadevam) # AVś.5.11.11d; 7.2.1a; AVP.8.1.11b. P: atharvāṇam Kauś.59.18.
athā jīvrī vidatham ā vadāsi # ApMB.1.9.4d; JG.1.22d. See under atha jivrir.
athā śiraḥ prati vām aśvyaṃ vadat # RV.1.119.9d.
atho dyumat samitim ā vadāni # AVP.1.66.3d.
atho ye viśyānāṃ vadhāḥ # AVś.6.13.1c.
atho yo viśvadāvyaḥ # AVś.3.21.9c; AVP.3.12.9c.
adabdhasya svadhāvataḥ # RV.8.44.20a; KS.40.14a.
adāsyann agna uta saṃgṛṇāmi # AVś.6.119.1b. See aditsan vā, dāsyann adāsyan, dhipsyaṃ, and yad vādāsyan.
aditir asi viśvadhāyā viśvasya bhuvanasya dhartrī # VS.13.18; TS.4.2.9.1; MS.2.8.14: 117.16; KS.39.3; śB.7.4.2.7.
aditiṣ ṭvā (TS.KS. aditis tvā) devī viśvadevyāvatī (MS. -devyavatī) pṛthivyāḥ sadhasthe aṅgirasvat (TS. 'ṅgirasvat) khanatv avaṭa # VS.11.61; TS.4.1.6.1; MS.2.7.6: 81.9; 3.1.8: 9.18; 4.9.1: 121.11; KS.16.6; śB.6.5.4.3. Ps: aditis tvā devī viśvadevyāvatī KS.19.7; aditis tvā devī (Mś. aditiṣ ṭvā devī) Apś.16.5.8; Mś.6.1.2.15; aditiṣ ṭvā (TS. aditis tvā) TS.5.1.7.1; Kś.16.4.9.
adityā dvādaśī # KSA.13.12. See adityai etc.
adityai dvādaśī # TS.5.7.22.1. See adityā etc.
aduḥkhaṃ (SaṃhitopaniṣadB. atṛptaṃ) kurvann amṛtaṃ saṃprayachan # ViDh.30.47b; VāDh.2.10b; SaṃhitopaniṣadB.3b; N.2.4b. Cf. Mahābh.1.76.63.
adṛpyatā manasā revad āśāthe # RV.1.151.8d.
adṛṣṭān sarvāñ jambhayan # RV.1.191.8c. Cf. dṛṣṭam adṛṣṭam, viśvadṛṣṭo, and asyādṛṣṭān.
adṛṣṭā viśvadṛṣṭāḥ # RV.1.191.5c,6c.
ado giribhyo adhi yat pradhāvasi # TB.2.5.6.4a. Cf. under ado yad avadhāvati, and amuṣmād adhi parvatāt.
ado yad avadhāvati # AVś.2.3.1a. P: ado yat Kauś.25.6. Cf. ado giribhyo, amī ye ke, and asau yo 'vasarpati.
addhi tṛṇam aghnye viśvadānīm # RV.1.164.40c; AVś.7.73.1c; 9.10.20c; Kś.25.1.19c; Apś.9.5.4c; 15.12.3; N.11.44c. Cf. under attu tṛṇāni.
adyamānāni sarvadā # śB.14.4.3.1b; BṛhU.1.5.1b.
adrim arasāvadhīt # AVP.3.16.4b.
adharo mad asau vadāt svāhā # ApMB.2.21.32d. See next.
adhastād bhūmyā vada # HG.1.15.6b. Cf. adhaspadān.
adhaspadān ma ud vadata # RV.10.166.5d. Cf. adhastād.
adha svadhā adhayad yābhir īyate # RV.1.144.2d.
adhā jivrī vidatham ā vadāthaḥ # RV.10.85.27d. See under atha jivrir.
adhā te agne kim iha vadanti # RV.4.5.14c.
adhārayat pṛthivīṃ viśvadhāyasam # RV.2.17.5c.
adhā vṛtrāya pra vadhaṃ jabhāra # RV.2.30.3b.
adhā ha tvad vṛṣamaṇo bhiyānāḥ # RV.4.22.6c.
adhi tvā sthāsyati # VS.6.2; MS.1.2.14: 23.12; śB.3.7.1.9. See vanaspatir adhi, and vanaspatis tvādhi-.
adhyāpitā ye guruṃ nādriyante # VāDh.2.11a; N.2.4a. Cf. SaṃhitopaniṣadB.3 (comm.).
adhvaryo brahma vadāma (7.2.3.12, vadāva) # Mś.7.2.3.12; 9.1.4.14.
anādhṛṣṭābhir ūtibhiḥ # RV.4.32.5b; 8.102.15b; SV.2.922b. Cf. anavadyābhir.
anānudo vṛṣabho dodhato vadhaḥ # RV.2.21.4a.
anānubhūtīr avadhūnvānaḥ # RV.6.47.17c.
anāso dasyūṃr amṛṇo vadhena # RV.5.29.10c.
anutta svād āsthānāt # śB.11.5.5.8c.
anupauhvad (ApMB. anu po 'hvad) anupahvayet (ApMB. anuhvayaḥ) # HG.1.14.4a; ApMB.2.22.9a (ApG.8.23.7).
anumatyai caruṃ vaiśvānaraṃ dvādaśakapālam # MS.3.15.11: 181.5.
anu manyatāṃ trivṛtā vadhena # AVP.2.59.9d. See next.
anu svadhāṃ vavakṣitha # RV.8.88.5d. See ati viśvaṃ.
anu svadhāṃ gabhastyoḥ # RV.1.88.6d.
anu svadhā cikitāṃ (KS. -kite) somo agniḥ # AVś.6.53.1c; AVP.4.3.7c; KS.37.9c; TB.2.7.8.2c; 16.2c.
anu svadhām akṣarann āpo asya # RV.1.33.11a; MS.4.14.12a: 235.7; TB.2.8.3.4a.
anu svadhām āyudhair yachamānāḥ # RV.7.56.13d; MS.4.14.18d: 247.11; TB.2.8.5.6d.
anu svadhāmitā dasmam īyate # RV.5.34.1b.
anu svadhām ṛbhavo jagmur etām # RV.4.33.6b.
anu svadhā yam upyate # RV.1.176.2c.
anu svadhāvarī sahaḥ # RV.7.31.7b.
anu svadhāvne kṣitayo namanta # RV.5.32.10d.
anu svadhā svadhā # Aś.2.19.18.
anūrādhāsa iti yad vadanti # TB.3.1.2.1b.
anedyā anavadyā ariṣṭāḥ # RV.6.19.4d.
anenāśvena medhyeneṣṭvāyaṃ rājāpratidhṛṣyo 'stu # TB.3.8.5.2; Apś.20.4.2; ... rājā vṛtraṃ vadhyāt TB.3.8.5.1; Apś.20.4.1; ... rājā sarvam āyur etu TB.3.8.5.4; Apś.20.4.4; ... rājāsyai viśo bahugvai bahvaśvāyai bahvajāvikāyai bahuvrīhiyavāyai bahumāṣatilāyai bahuhiraṇyāyai bahuhastikāyai bahudāsapuruṣāyai rayimatyai puṣṭimatyai bahurāyaspoṣāyai rājāstu TB.3.8.5.2; Apś.20.4.3. See prec.
antarhitā me samudrā dvādaśa # AVP.13.2.2a.
antaḥ santo 'vadyāni punānāḥ # RV.6.66.4b.
antāya bahuvādinam # VS.30.19; TB.3.4.1.13.
annapāne ca sarvadā # TA.7.4.2d; TU.1.4.2d.
annaṃ payasvad bahulaṃ me astu # JG.1.23d.
annaṃ brahmāṇo jarasaṃ vadanti # TB.2.8.8.3c.
annaṃ māṃsavad ghṛtavat svadhāvat # HG.2.15.9b; ApMB.2.20.33b.
annena manuṣyāṃs trāyase tṛṇaiḥ paśūn kartena sarpān yajñena devān svadhayā pitṝn svāhā # ApMB.2.17.3 (ApG.7.18.7). See next.
anyatra tvad rudatyaḥ saṃ viśantu # SMB.1.1.13b; ApMB.1.4.9b; HG.1.19.7b; JG.1.20b.
anyo anyam upa vadantam eti # RV.7.103.3d.
anyo anyasmai valgu vadanta eta # AVś.3.30.5c; AVP.5.19.5c.
anv eko vadati yad dadāti tat # RV.2.13.3a.
apa jijyāsato vadham (TS. jahi) # RV.10.152.5b; AVś.1.21.4b; AVP.2.88.5b; TS.3.5.8.1b.
apa ny adhuḥ pauruṣeyaṃ vadhaṃ yam (AVP. vadhaṃ mat) # AVś.19.20.1a; AVP.1.108.1a.
apahataṃ rakṣaḥ # VS.1.9,16; MS.4.1.6: 8.8; KS.1.5; 31.4; śB.1.1.2.15; 4.21. P: apahatam Kś.2.3.17; 4.19. Cf. antaritaṃ etc., avabāḍhaṃ etc., avadhūtaṃ etc., and parāpūtaṃ etc.
apāṅ prāṅ eti svadhayā gṛbhītaḥ # RV.1.164.38a; AVś.9.10.16a; ā.2.1.8.11a; N.14.23a.
apādam atraṃ mahatā vadhena # RV.5.32.8c.
apāṃ payasvad it (AVP.KS. yat) payaḥ # RV.10.17.14c; AVP.2.76.1c; KS.35.4c. See under prec.
apāṃ peruṃ jīvadhanyaṃ bharāmahe # RV.10.36.8a.
aprajāḥ santv atriṇaḥ # RV.1.21.5c; VāDh.17.3. Cf. BṛhD.1.58.
apsā yāti svadhayā daivyaṃ janam # RV.9.71.8c.
apsu svādiṣṭho madhumāṃ ṛtāvā # RV.9.97.48c.
abadhiṣma rakṣo 'badhiṣmāmum asau hataḥ (VSK. rakṣo 'muṣya tvā badhāyāmum abadhiṣma) # VS.9.38; VSK.11.1.4; śB.5.2.4.19--20. P: abadhiṣma rakṣaḥ Kś.15.2.8. See avadhiṣma, and cf. idam ahaṃ rakṣo 'va bādhe.
abdaivatam (sc. sūktam), abliṅgam (sc. sūktam), and abliṅgāḥ (sc. ṛcaḥ) # designations of the three stanzas, āpo hi ṣṭhā mayobhuvaḥ (q.v.) GDh.25.7; ViDh.56.16; BDh.2.4.7.2; 10.17.37; 3.2.7; 4.2.13; VāDh.28.13; MDh.8.106; 11.133; YDh.1.24; LAtDh.3.14; VAtDh.3.14; Karmap.2.1.5.
abhago (AVP. -bhagā) bhagavadbhyaḥ # AVś.5.31.11d; AVP.5.24.5d.
abhijitāsy abhi no vada # Kauś.106.7b.
abhi tiṣṭha śardhato vādhryaśva # RV.10.69.12d.
abhi te 'dhāṃ sahamānām # AVś.3.18.6a. P: abhi te 'dhām Kauś.36.20. See abhi tvādhāṃ, and upa te 'dhāṃ.
abhi tvādhāṃ sahīyasā # RV.10.145.6b; ApMB.1.15.6b. See abhi te 'dhāṃ, and upa te 'dhāṃ, and cf. next.
abhi tvādhām abhidhinā # AVP.1.98.3a. Cf. prec.
abhipramurā juhvā svadhvaraḥ # RV.10.115.2c.
abhivrajadbhir vayunā navādhita # RV.1.144.5d.
abhi śūlaṃ nihatasyāvadhāvati # RV.1.162.11b; VS.25.34b; TS.4.6.8.4b; MS.3.16.1b: 182.16; KSA.6.5b.
abhi svadhābhis tanvaḥ pipiśre # RV.5.60.4b.
abhyarṣan (SV. abhy arṣa) stotṛbhyo vīravad yaśaḥ # RV.9.106.13c; SV.1.576c.
abhrātṛkāṃ pradāsyāmi # VāDh.17.17a.
amanthiṣṭāṃ bhāratā revad agnim # RV.3.23.2a.
amamriś cit sāprathovadadahim (?) # AVP.5.27.2a (corrupt).
amātyān (and amātyapatnīḥ) svadhā namas tarpayāmi # BDh.2.5.10.2.
amāvāsye na tvad etāny anyaḥ # AVś.7.79.4a. Cf. prajāpate na etc.
amitrī bhītā samare vadhānām (AVP. vadhānā) # AVś.5.20.5d; AVP.9.27.5d. Cf. next.
amitrī senā samare vadhānām # AVś.11.10.25b. Cf. prec.
amī ye ke sarasyakā avadhāvati # HG.2.7.2a; ApMB.2.16.7c (ApG.7.18.1). Cf. ado yad avadhāvati, and ado giribhyo.
amukthā yakṣmād duritād avadyāt # AVś.2.10.6a. See amoci yakṣmād.
amuṣmai svadhā namaḥ # HG.2.10.7 (bis). See next.
amuṣmai svadhāmuṣmai svadhā # JG.2.1. See prec.
amoci yakṣmād duritād avartyai (AVP. avadyāt) # AVP.2.3.5a; TB.2.5.6.2a; ApMB.2.12.9a (ApG.6.15.4). See amukthā.
ayaṃ vai tvad asmād asi tvam etad ayaṃ te yonir asya yonis tvam # JB.1.47ab. See prec. and next.
ayaṃ vai tvām ajanayad ayaṃ tvad adhijāyatām asau svāhā # śś.4.14.36. See asmād vai tvam, and asmāt tvam adhijāto.
ayaṃ samudra iha viśvadevyaḥ (TB.Apś. viśvabheṣajaḥ) # RV.1.110.1c; TB.3.7.11.2c; Apś.3.11.2c.
ayaṃ sindhubhyo abhavad u lokakṛt # RV.9.86.21b; SV.2.173b.
ayaṃ su tubhyaṃ varuṇa svadhāvaḥ # RV.7.86.8a; Aś.3.7.15.
ayaṃ svādur iha madiṣṭha āsa # RV.6.47.2a.
ayaṃ hi tvā svadhitis tetijānaḥ # VS.5.43a; śB.3.6.4.14a. P: ayaṃ hi tvā Kś.6.1.18. See yaṃ tvām ayaṃ svadhitis.
ayaṃ ca yaḥ pavate viśvadānīm # AVP.9.3.1b.
ayaṃ jarimṇaḥ śevadhiḥ # AVś.7.53.5c; AVP.1.61.4c.
ayanaṃ mā vivadhīr (Tā. -badhīr) vikramasva # TA.3.15.1d; Tā.10.49d.
ayaṃ tvad adhijāyatām # TA.6.4.2b. See tvad ayaṃ.
ayaṃ nābhā vadati valgu vo gṛhe # RV.10.62.4a.
ayaṃ no vidvān vanavad vanuṣyate # RV.9.77.4a.
ayam agnir vadhryaśvasya vṛtrahā # RV.10.69.12a.
ayāṃsam u maghavadbhyaḥ suvṛktim # RV.2.35.15b.
ayuyutsann anavadyasya senām # RV.1.33.6a.
araṃgaro vāvadīti # AVś.20.135.13a; śś.12.16.1.3a; AG.2.9.4a.
arandhayan mānuṣe vadhrivācaḥ # RV.7.18.9d.
arājānaś ca vadanaiḥ punanti # AVP.1.92.2d.
arāmadantam avadalam # AVP.6.14.2a.
arundhatyaḥ saṃ vadante # AVP.15.16.1a.
algaṇḍūn (AVś. vulgate, alāṇḍūn) hanmi mahatā vadhena # AVś.2.31.3a; AVP.2.15.3a.
avaṛtyai (TB. avartyai) badhāyopamanthitāram (TB. vadhā-) # VS.30.12; TB.3.4.1.8.
avadānāni te pratyavadāsyāmi # TB.3.7.5.5; Apś.2.18.9. See vanuṣanty.
avadhūtaṃ rakṣaḥ # VS.1.14,19; TS.1.1.5.1; 6.1; MS.1.1.6: 3.11; 1.1.7: 4.2; 4.1.6: 8.1; 4.1.7: 9.5; KS.1.5,6; 31.4,5; śB.1.1.4.4; 2.1.14; TB.3.2.5.5; 6.1; Apś.1.19.3; Mś.1.2.2.6. P: avadhūtam Kś.2.4.2. Cf. under apahataṃ rakṣaḥ.
avadhūtā arātayaḥ (MS.KS. avadhūtārātiḥ) # VS.1.14,19; TS.1.1.5.1; 6.1; MS.1.1.6: 3.11; 1.1.7: 4.2; KS.1.5,6; 31.4,5; śB.1.1.4.4; 2.1.14; TB.3.2.5.5; 6.1; Apś.1.19.3.
avapatantīr avadan (AVP. apadam) # RV.10.97.17a; AVP.11.7.4a; VS.12.91a; TS.4.2.6.5a; MS.2.7.13a: 94.13; KS.16.13a. See avayatīḥ sam avadanta, and cf. pippalyaḥ samavadanta.
avayatīḥ sam avadanta # VSK.13.6.17a. See avapatantīr etc.
ava rakṣo divaḥ sapatnaṃ vadhyāsam # Apś.1.19.11.
ava rudrā aśaso hantanā vadhaḥ # RV.2.34.9d.
ava sthirā maghavadbhyas tanuṣva # RV.2.33.14c; VS.16.50c; TS.4.5.10.4c; MS.2.9.9c: 127.14; KS.17.16c.
avādhamaṃ vi madhyamaṃ śrathāya # RV.1.24.15b; AVś.7.83.3b; 18.4.69b; ArS.1.4b; VS.12.12b; TS.1.5.11.3b; 4.2.1.3b; MS.1.2.18b: 28.8; 4.14.17b: 246.5; KS.3.8b; 16.8b; śB.6.7.3.8; SMB.1.7.10b. P: avādhamam ... vi madhyamam HG.1.9.10.
avindethām apacitiṃ vadhatraiḥ # RV.4.28.4d.
aviṣaṃ naḥ pituṃ paca # MS.1.6.2: 89.3. See prec. three, and cf. svaditaṃ naḥ etc.
avṛjinā anavadyā ariṣṭāḥ (MS. adabdhāḥ) # RV.2.27.2d; MS.4.12.1c: 177.12. See asvapnajo etc.
avaindha saptavadhraye # AVP.9.7.3d.
aśaṃ te śvaśrūr vadatu # AVP.5.34.1a.
aśyāma te deva gharma ṛbhūmato vibhūmato vājavato bṛhaspativato viśvadevyāvataḥ pitṛmato 'ṅgirasvataḥ # MS.4.9.9: 130.2. P: aśyāma te deva gharma Mś.4.3.35. See under prec. but one.
aśyāma te deva gharma madhumato vājavataḥ pitumato 'ṅgirasvataḥ svadhāvinaḥ (AB.Aś. madhumataḥ pitumato vājavato 'ṅgirasvataḥ) # AB.1.22.10; TA.4.10.5; Aś.4.7.4. P: aśyāma te deva gharma madhumato vājavataḥ pitumataḥ TA.5.8.12; śś.5.10.31. See under prec. but two.
aśvam ivādhukṣad dhunim antarikṣam # RV.10.149.1c; N.10.32c.
aśvavat (RV. aśvāvat) soma vīravat # RV.9.63.18b; SV.2.245c; VS.8.63b; JB.3.60c. See aśvāvad vājavat.
aśvād iyāyeti yad vadanti # RV.10.73.10a; JB.3.364a,365a.
aśvā saptī ivādane # RV.6.59.3b.
aṣṭācakrā navadvārā # AVś.10.2.31a; TA.1.27.2a.
aṣṭau ca me dvādaśa ca me # VS.18.25.
aṣṭau ca śatāni muhūrtān yān vadanti # GB.1.5.5b. See aṣṭau śatā yan.
aṣṭau śatā yan mitaṃ tad vadanti # śB.12.3.2.8b. See aṣṭau ca śa-.
asaścatā maghavadbhyo hi bhūtam # RV.7.67.9a.
asi maghavā maghavadbhya indo # RV.9.97.55d.
asura āptaḥ svadhayā samadguḥ # AVP.6.2.6d. Cf. asur ātmā.
asurāḥ santaḥ svadhayā caranti # VS.2.30b; śB.2.4.2.15b; Aś.2.6.2b; śś.4.4.2b; Apś.1.8.7b; Kauś.88.1b; SMB.2.3.4b; JG.2.2b. Cf. apayantv asurāḥ.
asūyakāyānṛjave 'yatāya # VāDh.2.8c; ViDh.29.9c; N.2.4c.
aso havyavāḍ uta naḥ purogāḥ # RV.10.124.1c.
astāvy agniḥ śimīvadbhir arkaiḥ # RV.1.141.13a.
astāsi śatrave vadham # RV.10.133.3c; AVś.20.95.4c; SV.2.1153c.
asti tvādātam adrivaḥ # RV.5.39.1b; SV.1.345b; 2.522b; JB.3.203b; PB.14.6.4b; N.4.4b.
asti svadhāpate madaḥ # RV.6.44.1d--3d; SV.1.351d.
astu svadhā # GB.2.1.24; śB.2.6.1.24; TB.1.6.9.5; Aś.2.19.18; Vait.9.11,12; Kś.5.9.11; Apś.8.15.11; Mś.1.7.6.32; AG.4.7.31; YDh.1.244; BṛhPDh.5.278. See under oṃ svadhā.
astu svadheti vaktavyam # Vait.9.12c. Cf. oṃ svadhocyatām, and prakṛtebhyaḥ svadhocyatām.
asthīni mṛtyor juhomy asthibhir mṛtyuṃ vāsaye # VāDh.20.26. Cf. GDh.24.6.
asmākam astu pitṛṣu svadhāvat # AVś.7.41.2d; AVP.2.60.3d.
asmād vai tvam ajāyathā ayaṃ tvad adhi jāyatām asau svargāya lokāya (Kauś. omits svarlok-) svāhā # AG.4.3.27; Kauś.81.30. See next, and under ayaṃ vai tvām.
asmin yajñe svadhayā madantaḥ # VS.19.58c.
asmin yajñe svadhvare # RV.8.44.13c; SV.2.1062c.
asmin rāṣṭram adhi śraya # TS.4.2.1.4d; 5.2.1.4. See asme rāṣṭrāṇi, and mā tvad rāṣṭram.
asmin saṃvatsare mariṣyasy asminn ayane 'sminn ṛtāv asmin māse 'sminn ardhamāse 'smin dvādaśarātre 'smin ṣaḍrātre 'smiṃs trirātre 'smin dvirātre 'sminn ahorātre 'sminn ahany asyāṃ rātrāv asyāṃ velāyām asmin muhūrte mariṣyasi # Svidh.3.8.3.
asya made jaritar indra iha śravad iha somasya matsat # śś.8.25.1.
asya made jaritar indra iha śravad upa giri (!) ṣṭhāt # śś.8.25.1.
asya made jaritar indro 'pinvad apito 'jinvad ajuvaḥ # śś.8.25.1.
asya vāmasya palitasya hotuḥ # RV.1.164.1a; AVś.9.9.1a; ā.1.5.3.7; 5.3.2.14; śś.18.22.7; N.4.26a. P: asya vāmasya Kauś.18.25. Cf. BṛhD.4.32 (B). Designated as asya-vāmīya (sc. sūkta) VāDh.26.6; MDh.11.251; VAtDh.2.5; VHDh.5.129,156,166,376,442,449; 6.44,439; Rvidh.1.26.2; BṛhD.4.31; as palita CūlikāU.11; as salilaṃ vaiśvadevam śś.18.22.7.
asyāṃ yo jāyate putraḥ # VāDh.17.17c.
asvapnaś ca tvānavadrāṇaś ca rakṣatām # AVś.8.1.13b. See next, and next but two.
asvapnaś ca mānavadrāṇaś cottarato gopāyetām (KSṃG. ca dakṣiṇato gopāyatām) # KS.37.10; PG.3.4.17; MG.2.15.1. See under prec.
ahaṃ yavāda urvajre antaḥ # RV.10.27.9b. P: ahaṃ yaveti (!) VHDh.5.424.
ahaṃ rudrebhir vasubhiś carāmi # RV.10.125.1a; AVś.4.30.1a. P: ahaṃ rudrebhiḥ śś.6.11.11; Kauś.10.16; 139.15; Rvidh.4.4.4; VHDh.5.128. Cf. BṛhD.8.43. Designated as vākṣūktam VāDh.28.13; LAtDh.3.14.
ahaṃ vai tvad uttarāsmi # AVP.1.98.4a.
ahaṃ śuṣṇasya śnathitā vadhar yamam # RV.10.49.3c.
ahaṃ satyam anṛtaṃ yad vadāmi # AVś.6.61.2c,3c.
ahaṃ tvad asmi mad asi tvam etat # TB.1.2.1.20a; 2.5.8.7a; 3.7.7.10a; Kś.3.6.12a; Apś.5.16.1c; 12.24.5. P: ahaṃ tvad asmi Kś.10.9.32; Apś.10.20.19.
ahaṃ tvad ugras tviṣitas tviṣīmān # AVP.2.68.6c.
ahaṃ tveḍe abhibhūḥ svād gṛhāt # AVś.14.2.19b.
aham ayaṃ bhoḥ # VāDh.13.44. See ayam ahaṃ bhoḥ, and cf. aham, and prec.
aham ādityair uta viśvadevaiḥ # RV.10.125.1b; AVś.4.30.1b.
aham eva svayam idaṃ vadāmi # RV.10.125.5a; AVś.4.30.3a.
ahaṃ pravaditā syām # ArS.3.10f.
ahiṃ ca vṛtrahāvadhīt # RV.8.93.2c; AVś.20.7.2c; SV.2.801c.
ahir budhnyaḥ śṛṇavad vacāṃsi me # RV.10.66.11c.
aheḍayann uccarasi svadhā anu # RV.10.37.5b.
ā kāmam ṛṇve vadhvaḥ # RV.5.74.5d.
āgrayaṇaś (MS.KS. āgrāyaṇaś) ca me vaiśvadevaś (KS. kṣullakavaiśvadevaś) ca me # VS.18.20; TS.4.7.7.1; MS.2.11.5: 143.5; KS.18.11.
āghāṭāḥ karkaryaḥ saṃvadanti # AVP.12.7.8b. See yatrāghāṭāḥ.
ācāryapatnīḥ svadhā namas tarpayāmi # BDh.2.5.10.2.
ācāryān svadhā namas tarpayāmi # BDh.2.5.10.2.
ā juhotā svadhvaram # RV.3.9.8a.
ā juhvad dhavyam ānuṣak # SV.1.82c.
āṇḍīkam ivādhi puṣkarāt # AVP.10.2.10d.
ā tugraṃ śaśvad ibhaṃ dyotanāya # RV.6.20.8c.
ātmamukhe mṛtyor āsye juhomi # GDh.24.6. Cf. VāDh.20.26.
ātmānam upāvadhīḥ # Apś.10.2.11.
ā tvā grāvā vadann iha # RV.8.34.2a; SV.2.1159a.
ā tvādya viśve vasavaḥ sadantu # RV.10.142.6d.
ād aha svadhām anu # RV.1.6.4a; AVś.20.40.3a; 69.12a; SV.2.201a; JB.3.38a; Aś.7.2.3. P: ād aha svadhām śś.9.17.2. Cf. BṛhD.2.139.
ādityam eva te parivadanti sarve # AVś.10.8.17c; TA.2.15.1c.
ādityavadgaṇasya soma deva te matividas tṛtīyasya savanasya jagatīchandasa indrapītasya narāśaṃsapītasya pitṛpītasya madhumata upahūtasyopahūto bhakṣayāmi (Mś. savanasya jagacchandaso 'gnihuta indrapītasya) # TS.3.2.5.3; Mś.2.5.1.33. P: ādityavadgaṇasya (followed by fragments ... narāśaṃsapītasya ... indrapītasya ...) Apś.12.24.7,9. Cf. under tasya ta.
ādityavarṇaṃ tamasaḥ parastāt (TA.3.12.7b, tamasas tu pāre) # VS.31.18b; TA.3.12.7b; 13.1b; śvetU.3.8b; Bhagavadgītā 8.9.
ādityās tvā kṛṇvantu (KS. kurvantu) jāgatena chandasāṅgirasvat (MS. -vad ukhe) # VS.11.58; TS.4.1.5.4; MS.2.7.6: 80.17; KS.16.5; śB.6.5.2.5. P: ādityās tvā Kś.16.3.28; Mś.6.1.2.8.
ādityās tvāchṛndantu jāgatena chandasāṅgirasvat (MS. -vad ukhe) # VS.11.65; TS.4.1.6.3; MS.2.7.6: 82.4; KS.16.6; śB.6.5.4.17.
ād it svadhām iṣirāṃ pary apaśyan # RV.1.168.9d; 10.157.5b; AVś.20.63.3b; 124.6b.
ād id gandharvo abhavad dvitīyaḥ # VS.17.32b; TS.4.6.2.3b; MS.2.10.3b: 134.16; KS.18.1b.
ād id yaviṣṭho abhavad ghṛṇā śuciḥ # RV.1.141.4d.
ā naḥ some svadhvare # RV.8.50 (Vāl.2).5a.
ānīd avātaṃ svadhayā tad ekam # RV.10.129.2c; TB.2.8.9.4c.
ā no aśvāvad aśvinā # RV.8.22.17a.
ā no rādhāṃsi savita stavadhyai # RV.7.37.8a.
ān menāṃ kṛṇvann acyuto bhuvad goḥ # RV.10.111.3c.
āpa iva sadhryañco dhavadhve # RV.5.60.3d; TS.3.1.11.6d; MS.4.12.5d: 193.14.
āpas tad ghnantu te sadā (YDh. ghnantu sarvadā) # MG.2.14.26d; YDh.1.282d.
āpo achāvadāmasi # AVś.19.2.3d; AVP.8.8.9d.
āpo devīḥ svadantu (VSK. sadantu) svāttaṃ cit sad devahaviḥ # VS.6.10; VSK.6.2.4; śB.3.7.4.6. P: āpo devīḥ Kś.6.3.32. See svāttaṃ sad, svāttaṃ havyaṃ, and svāttaṃ cit.
āpo hi ṣṭhā mayobhuvaḥ # RV.10.9.1a; AVś.1.5.1a; SV.2.1187a; VS.11.50a; 36.14a; TS.4.1.5.1a; 5.6.1.4a; 7.4.19.4a; MS.2.7.5a: 79.16; 3.1.6: 8.10; 4.9.27a: 139.3; KS.16.4a; 19.5; 35.3a; śB.6.5.1.2; TB.3.9.7.5; TA.4.42.4a; 10.1.11a; KA.1.219a; 3.219; Apś.7.21.6; 9.12.2; 18.8; 13.15.13; 14.18.1; 16.4.1; AG.2.8.12; 9.8; 4.6.14; Kauś.6.17; HG.1.10.2; 21.5; 2.18.9; MG.1.2.11; ApMB.2.7.13a (ApG.5.12.6); BDh.2.5.8.11; LVyāsaDh.2.19; N.9.27a. P: āpo hi ṣṭhā MS.2.13.1: 153.4; KSA.4.8; Aś.5.20.6; śś.4.11.6; 15.3; 8.6.7; 7.12,20; 9.28.6; 14.57.7; Vait.28.11; Kś.16.3.16; Mś.4.3.43; 6.1.2.2; 6.1.6.19 (20); PG.1.8.6; 2.2.14; 6.13; 14.21; 3.5.4; VārG.9.9; ViDh.64.18; 65.3; GDh.26.10; ParDh.11.34; 12.10; LVyāsaDh.1.22; VHDh.8.25; BṛhPDh.2.38,50,56,129; Rvidh.1.3.5; 4.10; 3.4.3,6. Designated as āpo-hi-ṣṭhīyam (sc. sūktam) śG.3.1.4; āpo-hi-ṣṭhāḥ (sc. ṛcaḥ) VāDh.15.20; VHDh.4.30; āpo-hi-ṣṭhīyāḥ (sc. ṛcaḥ) śś.4.11.6; 21.5; 8.6.7; 7.12,20; 14.57.7; Lś.2.10.20; 3.6.6; 4.11.7; Apś.15.11.16; 20.18.7; śG.1.14.8; MG.1.1.24; 6.4; 11.26; 2.2.27; Svidh.1.2.5. This and the next hymn of AVś. (1.6.1) are designated as śaṃbhumayobhū (sc. sūkte) Vait.10.19; Kauś.9.1,4; 18.25; 19.1; 41.14; 43.12; this hymn alone as sindhudvīpasya sūktam Rvidh.3.11.4. Cf. BṛhD.6.153. See abdaivatam.
ābhyo yonibhyo adhi jātavedāḥ # Kauś.133.6b. See ebhyo etc., and svād yoner.
ā yad rayiṃ guhadavadyam asmai # RV.2.19.5c.
ā yāhi śaśvad uśatā yayātha # RV.6.40.4a.
āyukṛd āyuḥpatnī svadhā vaḥ # Apś.6.21.1. See āyuṣkṛd āyuṣpatnī, and āyuṣkṛd āyuṣmatī.
āyur mā nirvādiṣṭam # VS.5.17; śB.3.5.3.18.
āyuṣkṛd āyuṣpatnī svadhāvantau (KS. corruptly āyuṣ ṭad āyupatniḥ svadhāvaḥ) # AVś.5.9.8; KS.37.15. See under āyukṛd.
āyuṣkṛd āyuṣmatī svadhāvantau # AVP.6.12.1. See under āyukṛd.
āyuṣmantaḥ priyam eṣāṃ vadantaḥ # AVś.6.47.2c; TS.3.1.9.2c; Kś.9.14.17c. See sumedhasaḥ etc.
āyuṣmantas tvad varcasvanta ud geṣma # JB.1.84.
ā rabhasva brahmaṇā vaiśvadevīm # AVP.14.5.4a.
ārāt tvad anyā vanāni vṛkṣi # AVś.6.30.2c.
ārād upa svadhā gahi # RV.8.32.6c.
āre gohā nṛhā vadho vo astu # RV.7.56.17c.
ā roha vadhv amṛtasya lokam # ApMB.1.6.4c. See next.
ārtyai janavādinam # VS.30.17. See ṛtyai etc.
ārdraṃ (AVP. ārdaṃ) tad adya sarvadā # AVś.1.32.3c; AVP.1.23.3c.
ālikhann animiṣaḥ kiṃvadanta upaśrutir haryakṣaḥ kumbhī śatruḥ pātrapāṇir nṛmaṇir hantrīmukhaḥ sarṣapāruṇaś cyavano naśyatād itaḥ svāhā # PG.1.16.23. See next, aryamṇaḥ kumbhī, and āntrīmukhaḥ.
ālikhan vilikhann animiṣan kiṃvadanta upaśrutiḥ svāhā (JB. omits svāhā) # HG.2.3.7; JG.1.8. See prec.
ā vaṃsate maghavā vīravad yaśaḥ # RV.8.103.9a; SV.2.229a.
āvadaṃs tvaṃ śakune bhadram ā vada # RV.2.43.3a; RVKh.2.43.6a; AG.3.5.7; śG.4.5.8; Kauś.46.54a.
ā vāṃ yeṣṭhāśvinā huvadhyai # RV.5.41.3a.
ā vāṃ śaśvadbhir vavṛtīya vājaiḥ # RV.7.93.6d.
āvir bhuvad (ArS. bhuvann) aruṇīr yaśasā goḥ (ArS. gāvaḥ) # RV.4.1.16d; ArS.3.5d.
ā viśvadevaṃ satpatim # RV.5.82.7a; TS.3.4.11.2a; MS.4.12.6a: 196.14; AB.1.9.7; 4.32.2; 5.5.6; 19.8; KB.20.3; śB.13.4.2.13; Aś.2.16.11; 4.3.2; 11.6; 7.6.6. P: ā viśvadevam śś.9.26.3; 10.3.13; 16.1.21.
ā vo ruvaṇyum auśijo huvadhyai # RV.1.122.5a.
ā vo vāhiṣṭho vahatu stavadhyai # RV.7.37.1a.
āśvibhyāṃ prattaṃ svadhayā madadhvam # JG.2.1d.
ā sa etu ya īvad ā # RV.8.46.21a; śś.16.11.24. Cf. BṛhD.6.80.
āsavaṃ viśvadevyam # VS.22.14b.
āsātai vidathā vadan # AVś.18.3.70d.
ā sāyakaṃ maghavādatta vajram # RV.1.32.3c; AVś.2.5.7c; AVP.12.12.3c; TB.2.5.4.2c.
āsurī māyā svadhayā kṛtāsi # VS.11.69b; TS.4.1.9.2b; MS.2.7.7b: 82.15; 3.1.9: 11.16; KS.16.7b; śB.6.6.2.6.
āsthād rathaṃ svadhayā yujyamānam # RV.7.78.4c.
ā svadhā # TB.1.6.9.5; Apś.8.15.10. See under oṃ svadhā.
āharāvadya śṛtasya haviṣo yathā # TA.4.37.1a. P: āharāvadya śṛtasya Apś.15.19.7.
iḍā manuṣvad iha cetayantī # RV.10.110.8b; AVś.5.12.8b; VS.29.33b; MS.4.13.3b: 202.9; KS.16.20b; TB.3.6.3.4b; N.8.13b.
iti sālvīr avādiṣuḥ # ApMB.2.11.12b.
itthā dhiya ūhathuḥ śaśvad aśvaiḥ # RV.6.62.3b.
idaṃ rāṣṭraṃ prathatāṃ sarvadaiva # AVP.10.4.11d.
idaṃ kṣatraṃ mitravad ārdradānu (KS. ārdradānvojaḥ; AVP. ārdradānvojā, followed by m-; Aś. ārdradātum) # AVP.15.1.8c; TS.4.4.12.3c; MS.3.16.4c: 188.13; KS.22.14c; Aś.4.12.2c.
idaṃ tām adya tvad vayam # AVś.6.90.1c.
idam asmai vacane vada # JB.1.79.
idam ahaṃ yo mā prācyā (also dakṣiṇāyā, pratīcyā, etc.) diśo 'ghāyur abhidāsād apavādīd iṣūguhaḥ tasyemau prāṇāpānāv apakrāmāmi brahmaṇā # Kauś.49.7--8. Cf. AVś.4.40; 5.10.
idaṃ pitāmahebhyo 'ntarikṣasadbhyaḥ # JG.2.2. Cf. svadhā pitṛbhyo 'ntarikṣasadbhyaḥ.
idaṃ pitṛbhyaḥ pṛthivīṣadbhyaḥ # JG.2.2. See svadhā pitṛbhyaḥ pṛthiviṣadbhyaḥ.
idaṃ prapitāmebhyo diviṣadbhyaḥ # JG.2.2. Cf. svadhā pitṛbhyo diviṣadbhyaḥ.
indra ṛbhubhir vājavadbhiḥ samukṣitam # RV.3.60.5a; AB.6.12.6; GB.2.2.22; Aś.5.5.19; 9.5.5. P: indra ṛbhubhir vājavadbhiḥ Aś.7.7.7; śś.8.2.5; 14.3.12.
indra tvad araṇā iva # RV.8.1.13b; AVś.20.116.1b; PB.9.10.1b.
indra tvad ā kaś cana hi praketaḥ # RV.3.30.1d; VS.34.18d.
indra tvad yantu (Aś.śś. yanti) rātayaḥ # SV.1.453b,1120b; Aś.6.2.6d; śś.9.6.6b.
indra tvaṃ marudbhiḥ saṃ vadasva # RV.1.170.5c.
indra tvādātam id yaśaḥ # RV.1.10.7b; 3.40.6c; AVś.20.6.6c; SV.1.195c.
indra dṛhya maghavan tvāvad id bhuje # RV.10.100.1a. P: indra dṛhya śś.11.9.9. Cf. BṛhD.8.10.
indra dyumnaṃ svarvad (TB. suvar-) dhehy asme # RV.6.19.9d; 35.2d; MS.4.11.4d: 170.12; KS.9.19d; TB.2.5.8.1d; 8.5.8d.
indraṃ tam achā vada navyasyā matī # RV.8.51 (Vāl.3).3c.
indra piba svadhayā cit sutasya # RV.3.35.10a.
indrapītasya # Apś.12.24.9. Fragment of ādityavadgaṇasya TS.3.2.5.3.
indra pūṣan bṛhaspate pra ca vada pra ca yaja # śś.1.6.2. See agne pūṣan.
indram ādityavantam ṛbhumantaṃ vibhumantaṃ vājavantaṃ bṛhaspatimantaṃ (Aś. -vantaṃ) viśvadevyāvantam āvaha # KB.12.7; Aś.5.3.10; śś.6.9.13.
indravāyū svadhvaram # RV.4.46.4b.
indraḥ śaśvadbhir johūtra evaiḥ # ā.5.2.11c.
indraḥ śunāvad vitanoti sīram # TB.2.5.8.12a.
indras taṃ hantu mahatā vadhena # RV.7.104.16c; AVś.5.31.12c; 8.4.16c.
indras tān hantu mahatā vadhena # AVP.2.15.5d.
indrasya manmahe śaśvad id asya manmahe # AVś.4.24.1a. See indrasya manve prathamasya, and indrasya manve śaśvad.
indrasya manve śaśvad yasya manvire # AVP.4.39.1a. See prec., and indrasya manmahe.
indra svadhām anu hi no babhūtha # RV.1.165.5d; KS.9.18d. See indraḥ etc.
indra svadhāvo matsveha # RV.3.41.8c; AVś.20.23.8c.
indra svādiṣṭhayā girā śacīvaḥ # RV.3.53.2d.
indraḥ samudro abhavad gabhīraḥ # MS.4.14.7b: 225.7.
indraḥ svadhām anu hi no babhūtha # MS.4.11.3d: 168.15. See indra etc.
indrāgnibhyāṃ puroḍāśasyāvadīyamānasyānubrūhi # Apś.7.22.12.
indrā nv agnī avase huvadhyai # RV.5.45.4b.
indrāmavadāt (?) tamo vaḥ parastāt # SMB.2.6.12a. P: indrāmavadāt GG.4.8.24; KhG.4.3.9.
indrāya tvādityavate # VS.6.32; 38.8; TS.1.4.1.1; MS.1.3.3: 30.15; 4.5.4: 68.14; KS.3.10; śB.3.9.4.9; 14.2.2.7.
indrāya tvā viśvadevyāvate # TS.1.4.1.1.
indrāya vajraṃ nighanighnate vadham # RV.1.55.5d.
indrāya vasumate rudravata ādityavate viśvadevyāvate # JB.2.140.
indrāya vācaṃ vadata # VS.9.11; TS.1.7.8.1; MS.1.11.3: 163.9; KS.14.1; TB.1.3.6.3; śB.5.1.5.9; Apś.18.4.7; Mś.7.1.3.10.
indrāya vācaṃ saṃ vadata # MS.1.11.3: 163.9; KS.14.1.
indrāya śunāsīrāya dvādaśakapālaḥ # MS.1.10.1: 141.4.
indrāya sunvad ṛṣaye ca śikṣat # RV.10.27.22d.
indrāyenduḥ pavate svādur ūrmiḥ # RV.9.110.11b.
indrāvathuḥ (VSK. -vadhuḥ) kāvyair daṃsanābhiḥ # RV.10.131.5b; AVś.20.125.5b; VS.10.34b; 20.77b; VSK.11.47b; MS.3.11.4b: 146.3; KS.38.9b; śB.5.5.4.26b. See indrāvataṃ.
indrāviṣṇū aṣṭhīvadbhyām # TS.5.7.15.1; KSA.13.5.
indrāviṣṇū nṛvad u ṣu stavānā # RV.4.55.4c.
indrāsomā vartayataṃ divo vadham # RV.7.104.4a; AVś.8.4.4a.
indriyaṃ me vīryaṃ mā nir vadhīḥ (Mś. vadhiṣṭa) # TS.3.1.8.3; 2.4.2; Mś.2.3.3.10.
indro asyā ava vadhar jabhāra # RV.1.32.9b; AVP.12.12.9b.
indro deva iha śravad iha somaṃ pibatu # śś.8.17.1.
indro marutvāṃ iha śravad iha somasya pibatu # śś.8.16.1.
indro yad vṛtram avadhīn nadīvṛtam # RV.1.52.2c.
indro vajreṇa mahatā vadhena # RV.1.32.5b; AVP.12.12.5b; MS.4.12.3b: 185.9; TB.2.5.4.3b.
indro vṛtraṃ vajreṇāvadhīd dhi # MS.4.14.7a: 225.9.
indro haniṣyatāṃ vadham # AVP.2.31.3a.
indhāna enaṃ jarate (MS.KS. janate) svādhīḥ # RV.10.45.1d; VS.12.18d; TS.1.3.14.5d; 4.2.2.1d; MS.2.7.9d: 86.6; KS.16.9d; śB.6.7.4.3; ApMB.2.11.21d; N.4.24.
indhāno agniṃ vanavad vanuṣyataḥ # RV.2.25.1a; MS.4.14.10a: 230.15; TB.2.8.5.2a.
imaṃ yajñaṃ svadhayā ye yajante (KS.KA. dadante) # KS.34.19b; KA.1.198.9b; Aś.3.14.10b. See imaṃ ca yajñaṃ, and ya imaṃ yajñaṃ sva-.
imaṃ ca yajñaṃ sudhayā dadante # MS.1.7.1b: 109.1; 1.8.9b: 130.7. See under imaṃ yajñaṃ svadhayā.
imaṃ jīvaṃ jīvadhanyāḥ sametya # AVś.12.3.4b.
imaṃ devā asapatnaṃ suvadhvaṃ mahate kṣatrāya mahate jyaiṣṭhyāya mahate jānarājyāyendrasyendriyāya (VSK.11.3.2 stops at jyaiṣṭhyāya; VSK.11.6.2 at jānarājyāya) # VS.9.40; 10.18; VSK.11.3.2; 6.2; śB.5.3.3.12; 4.2.3. P: imaṃ devāḥ YDh.1.299.
imaṃ dhiṣṇyam udakumbhaṃ ca triḥ pradakṣiṇaṃ parivrajātha dakṣiṇaiḥ pāṇibhir dakṣiṇān ūrūn āghnānā ehy evā3 idaṃ madhū3 idaṃ madhv iti vadatyaḥ # ā.5.1.1.28.
imaṃ naḥ śṛṇavad dhavam # RV.8.43.22c; 10.26.9d.
imam indro 'prativadhaṃ kṛṇotu # AVP.3.27.5d.
imaṃ me pratisaṃvādinam # HG.1.15.6c.
imāṃ sameta (VārG. sametya) paśyata # RV.10.85.33b; AVś.14.2.28b; SMB.1.2.14b; PG.1.8.9b; ApMB.1.9.5b; HG.1.19.4b; MG.1.12.1b; JG.1.21b; VārG.14.25b. Cf. vadhūṃ sameta.
imāṃ ca naḥ pṛthivīṃ viśvadhāyāḥ # RV.3.55.21a.
ime yāmāsas tvadrig abhūvan # RV.5.3.12a.
ime rājānaḥ samityānyān vadheyuḥ # AVP.10.4.2b.
iyakṣanto na minanti svadhāvaḥ # RV.6.21.3d.
iyam antar vadati (AVP. vadaty ugrā) # AVś.5.30.16a; AVP.9.14.6a.
iṣaṃ stotṛbhyo maghavadbhya ānaṭ # RV.7.7.7c.
iṣaṃ duhan sudughāṃ viśvadhāyasam # RV.10.122.6a; KS.12.14a.
iṣam ā vada # TS.1.1.5.2; MS.1.1.6: 3.15; 4.1.6: 8.14; TB.3.2.5.8; Apś.1.20.2; Mś.1.2.2.17. See iṣam ūrjam ā vada.
iṣam ūrjam ā vada # VS.1.16; śB.1.1.4.18. See iṣam ā vada, and ūrjam ā vada.
iṣaṃ pinva maghavadbhyaḥ (KS. viśvavārāṃ) suvīrām # RV.7.24.6c; KS.13.16d.
iṣā mandasvād u te # RV.8.82.3a.
iṣudhīṃs tvad dhanus tvat # AVP.5.10.6d.
iha dyumattamaṃ vada # RV.1.28.5c; Apś.16.26.1c; Mś.6.1.7.23c; N.9.21c.
iha vidhṛtiḥ svāhā (HG.ApMB. iha vidhṛtiḥ) # TS.7.1.12.1; 18.2; 4.17.2; KSA.1.3; 4.6; TB.3.8.9.3; 12.2; HG.1.12.2; ApMB.2.18.6,7. See iha svadhṛtiḥ.
iha śravad iha somasya matsat # śś.8.18.1.
iha svadhṛtiḥ (VS.śB.śG.JG. svadhṛtiḥ svāhā) # VS.8.51; 22.19; MS.3.12.4: 161.11; AB.5.22.10; śB.4.6.9.8; 13.1.6.2; Aś.8.13.1; Lś.3.8.12; Apś.21.12.7; Mś.7.2.3.27; 9.2.2.5; śG.3.11.4; SMB.1.3.14; MG.1.1.22; JG.1.22. See iha vidhṛtiḥ.
ihaiva san niravadaye tad # TS.3.3.8.2c. See under ihaiva santaḥ prati tad.
īśāno yavayā vadham # RV.1.5.10c; AVś.20.69.8c.
ukthaiḥ svadhābhir devi pitṛbhir madantī # AVś.18.1.43b; 4.47b. See svadhābhir devi.
ugraṃ vaco apāvadhīt (SVṃS. apāvadhīḥ svāhā; TSṭB. apāvadhīm) # SV.1.353d; VS.5.8c (ter); TS.1.2.11.2; MS.1.2.7d: 17.5; KS.2.8 (bis); TB.1.5.9.5,6; śB.3.4.4.23c,24c,25c.
ugradhanvā pratihitābhir astā # RV.10.103.3d; AVś.19.13.4d; SV.2.1201d; VS.17.35d. See ūrdhvadhanvā.
ugreṇa te (AVP. tam) vacasā bādha ād (AVP. vādha id) u te # AVś.5.13.3b; AVP.8.2.1b.
ugro jajñe vīryāya svadhāvān # RV.7.20.1a; KS.17.18a; KB.21.2; ā.5.2.2.3. P: ugro jajñe Aś.7.7.2; 9.2.5; śś.11.7.7.
uccairvāji pṛtanāṣāṭ (HG. pṛtanāsāham; ApMB. -vādi pṛtanāji) # RVKh.10.128.3a; HG.1.10.6a; ApMB.2.8.2a (ApG.5.12.9).
uta gāva ivādanti (TB. ivādan) # RV.10.146.3a; TB.2.5.5.6a.
uta svayā tanvā saṃ vade tat # RV.7.86.2a.
uta svena kratunā saṃ vadeta # RV.10.31.2c.
utem ava tvaṃ vṛṣabha svadhāvaḥ # RV.3.35.3b.
uto tvad api nahyati # AVP.5.32.9b.
uto tvad asvakaṃ kṛtvā # AVP.5.32.9c.
uttiṣṭhad brāhmaṇāḥ saṃ vadadhvam # AVP.8.15.9a.
ut tvādityā vasavo bharantu # AVś.8.1.16c.
udagrābhasya namayan vadhasnaiḥ (SV. vadhasnum) # RV.9.97.15b; SV.2.158b.
udādāya pṛthivīṃ jīvadānum (TSṭB.Apś. jīradānuḥ; MS.KS. jīradānum) # VS.1.28b; TS.1.1.9.3b; MS.1.1.10b: 6.9; KS.1.9b; TB.3.2.9.13; śB.1.2.5.19; Apś.2.3.10.
udīcyāṃ tvā diśi purā saṃvṛtaḥ svadhāyām ā dadhāmi # AVś.18.3.33.
ud u tiṣṭha svadhvara # RV.8.23.5a; VS.11.41a; TS.4.1.4.1a; 5.1.5.3; MS.2.7.4a: 78.11; 3.1.5: 7.7; 4.9.12: 134.2; KS.16.4a; śB.6.4.3.9; KA.1.198.21a; Apś.16.3.8; Mś.3.5.4; 6.1.1.32. P: ud u tiṣṭha Kś.16.3.7.
ud ūrvād gā asṛjo aṅgirasvān # RV.6.17.6d.
udyantaṃ tvādityānūd iyāsam # SMB.2.5.15; GG.4.6.12. P: udyantaṃ tvā KhG.4.1.26.
undatīr iha māvata (VārG. iṣam āvada, corrupt) # KS.2.1; VārG.4.8.
upa jīvanti sarvadā # AVś.10.6.32b.
upa te 'dhāṃ sahamānām (AVś. sahīyasīm) # RV.10.145.6a; AVś.3.18.6b; ApMB.11.5.6a (ApG.3.9.6). P: upa te 'dhām Kauś.36.21. See abhi te 'dhāṃ, and abhi tvādhāṃ.
upapravada (RVKh. upaplavada) maṇḍūki # RVKh.7.103.1a; AVś.4.15.14a; AVP.5.7.13a; N.9.7a. Cf. Suparṇ.9.4a.
upaplavada # see upapravada.
upa mā yanti vadhrayaḥ # RV.8.46.30b.
upa yajñam asthita (Mś. astu no) vaiśvadevī # RVKh.9.86.1d; AVś.7.27.1d; Apś.4.13.4d; Mś.1.4.3.2d.
upasthāśānāṃ mitravad astv ojaḥ # AVP.15.1.7b; TS.4.4.12.3b; MS.3.16.4b: 188.10; Aś.4.12.2b. See next.
upa svadhābhiḥ sṛjathaḥ puraṃdhim # RV.1.180.6b.
upāruhaḥ śrathayan svādate hariḥ # RV.9.68.2b.
upāsate pitaraḥ svadhābhiḥ # AVś.18.4.36d.
upehi viśvadha # ā.4.14.
ubhā rājānā (AVś. -nau) svadhayā madantā (AVś. -tau) # RV.10.14.7c; AVś.18.1.54c; MS.4.14.16c: 242.13.
ubhā vām indrāgnī āhuvadhyai # RV.6.60.13a; VS.3.13a; TS.1.1.14.1a; 5.5.2a; 7.2; MS.1.5.1a: 65.10; 1.1.5: 73.11; 1.1.6: 74.4; KS.6.9a; 7.4; śB.2.3.4.12a; Aś.3.7.13; Apś.19.18.8. Ps: ubhā vām indrāgnī MS.1.5.5: 73.13; 4.13.5: 205.10; 4.14.8: 226.11; KS.7.5; TB.2.8.5.1; Mś.5.2.8.31; ubhā vām śś.2.11.2; 6.10.19.
ubhe vācā vadāmi te # AVś.5.30.2d--4d; AVP.9.13.2d--4d.
ubhe vācau vadati sāmagā iva # RV.2.43.1c.
uruṃ na indraḥ kṛṇavad u lokam # RV.7.84.2d.
uruśaṃso jaritre viśvadha syāḥ # RV.4.16.18d.
urūcy asmai ghṛtavad bharantī # RV.3.31.11c.
uṣo anu svadhām ava # RV.4.52.6c.
uṣo aśvāvad purubhojo asme # RV.7.75.8b.
ūdhar na gonāṃ svādmā pitūnām # RV.1.69.3b.
ūrubhyāṃ te aṣṭhīvadbhyām (ApMB.AVP.8.16.4a and 9.3.13a, 'ṣṭhī-) # RV.10.163.4a; AVś.2.33.5a; 20.96.20a; AVP.4.7.6a; 8.16.4a; 9.3.13a; ApMB.1.17.4a (ApG.3.9.10).
ūrū tad asya yad vaiśyaḥ # RV.10.90.12c; VS.31.11c; TA.3.12.6c; VāDh.4.2c. See madhyaṃ tad etc.
ūrjam apacitiṃ svadhām # VS.21.58e; MS.3.11.5e: 148.7; TB.2.6.14.6e.
ūrjam ā vada # TS.1.1.5.2; MS.1.1.6: 3.15; 4.1.6: 8.14; TB.3.2.5.8; Apś.1.20.2; Mś.1.2.2.17. See iṣam ūrjam ā vada.
ūrjasvatīḥ payasvatīḥ # TS.1.1.1.1; MS.2.8.14c: 118.18; 3.3.4: 36.6; TB.3.2.1.5. See ūrjasvatīḥ svadhā-.
ūrjasvatīm anamīvāṃ svādhyām # AVP.14.5.2b.
ūrjasvatīḥ svadhāvinīḥ (KS. svadhāyinīḥ) # TS.4.4.11.4c; KS.17.10. See ūrjasvatīḥ payasvatīḥ.
ūrjāṃ svadhām ajarāṃ sā ta eṣā # AVś.2.29.7b; AVP.1.13.4d.
ūrjā svadhā sacatām etam eṣā # AVP.1.13.4b.
ūrjo bhāgaṃ madhumat pinvamānā (Apś.KS.40.5b, sūnṛtāvat) # MS.2.7.12c: 92.8; KS.16.12c; 40.5b; Apś.16.34.4b. See under ūrjasvatī payasā, and cf. ūrjāvad agne.
ūrdhvāṃ dhītiṃ kṛṇavad dhārayac ca # RV.7.64.4b.
ūrdhvāyāṃ tvā diśi purā saṃvṛtaḥ svadhāyām ā dadhāmi # AVś.18.3.35.
ūrdhvā vāk samabhavat # VārG.14.13a. Cf. yāgre vāk samavadata.
ūrmir na nāvam ā vadhīt # RV.8.75.9c; TS.2.6.11.2c; MS.4.11.6c: 175.11; KS.7.17c; N.5.23c.
ūvadhyagohaṃ pārthivaṃ khanatāt # MS.4.13.4: 204.1; KS.16.21; AB.2.6.16; TB.3.6.6.3; Aś.3.3.1; śś.5.17.7; Apś.7.16.1. P: ūvadhyagoham śś.15.1.26.
ṛjur ic chaṃso vanavad vanuṣyataḥ # RV.2.26.1a.
ṛṇor apo anavadyārṇāḥ # RV.1.174.2c.
ṛtaṃ satyaṃ vijigyānaṃ vivācanam anto vāco vibhuḥ sarvasmād uttaraṃ jyotir ūdhar aprativādaḥ pūrvaṃ sarvaṃ vāk parāg arvāk sapru salilaṃ dhenu pinvati # ā.5.3.2.1.
ṛtaṃ ca satyaṃ ca vadata # TS.3.2.7.1; Aś.5.2.14; Vait.17.4. Cf. for this and the next, ṛtaś ca.
ṛtaparṇaka yo 'vadhīḥ # Apś.21.20.3b. Read ṛtuparṇa kayovadhī (? see Caland, ZDMG. lvī. 743).
ṛtam avādiṣam # TA.7.12.1; TU.1.12.1; MG.1.4.8; VārG.8.7.
ṛtam ṛtavādibhyaḥ # VS.5.7; TS.1.2.11.1; KS.2.8; MS.1.2.7: 17.2; AB.1.26.5; GB.2.2.4; śB.3.4.3.21; Aś.4.5.7; śś.5.8.5; Vait.13.24; Lś.5.6.9.
ṛtasya bodhy ṛtacit svādhīḥ # RV.4.3.4b.
ṛtāvānaṃ mahiṣaṃ viśvadarśatam # RV.10.140.6a; SV.2.1171a; VS.12.111a; TS.4.2.7.3a; MS.2.7.14a: 96.1; KS.16.14a; śB.7.3.1.34.
ṛtyai janavādinam # TB.3.4.1.14. See ārtyai etc.
ṛṣaye saptavadhraye # RV.5.78.6b.
ekaṃ sad viprā bahudhā vadanti # RV.1.164.46c; AVś.9.10.28c; N.7.18c.
ekam iṣe (TS. iṣa; comm. he iṣa sarvadevair iṣyamāna) # TS.3.2.6.1; TB.3.7.7.11; Apś.10.22.12; SMB.1.2.6; GG.2.2.11; KhG.1.3.26; PG.1.8.1; ApMB.1.3.7; ApG.2.4.16; HG.1.21.1; MG.1.11.18; JG.1.21 (bis); VārG.14.23. See under iṣa ekapadī.
ekavādyāṃ jighatsvam # AVś.2.14.1b. See ekāvādyāṃ.
ekādaśā dvādaśeṣu śrayadhvam # TB.3.11.2.2.
ekāvādyāṃ jighatsvam # AVP.2.4.1b. See ekavādyāṃ.
eko dṛḍham avado vṛtrahā san # RV.3.30.5b.
etat te tata svadhā # AVś.18.4.77.
etat te tatāmaha svadhā ye ca tvām anu # AVś.18.4.76. See etat te pitāmaha.
etat te pitar asau ye ca tvātrānu tebhyaś ca svadhā namaḥ # JG.2.2. Cf. under etat te tata ye.
etat te pratatāmaha svadhā ye ca tvām anu # AVś.18.4.75; Vait.22.22; Kauś.88.11. See etat te pitāmaha prapitāmaha.
etad bhavadbhyo bhavatībhyo 'stu cākṣayam # ViDh.74.8.
etad vaḥ pitaro vāsaḥ (VS. vāsa ādhatta) # VS.2.32; VSK.2.7.4; Aś.2.7.6; SMB.2.3.14; JG.2.2. Ps: etad vaḥ pitaraḥ JG.2.2; ViDh.73.12,13; etad vaḥ Kś.4.1.16; KhG.3.5.30. See etāni vaḥ, vaddhvaṃ, and cf. asāv etat te vāsaḥ.
etaṃ dviṣantam avadhiṣam # AVP.10.12.12a.
etāṃ vaiśvānara sarvadeva namo 'stu te # RVKh.10.142.9.
etā vācaḥ pravadantīḥ # TA.1.4.3c.
etās te svadhā amṛtāḥ karomi # TA.6.9.1a.
eto nv indraṃ stavāma (śuddham) # RV.8.95.7a; SV.1.350a; 2.752a; JB.3.228a. P: eto nv indraṃ stavāma śuddham Svidh.1.5.13. Designated as śuddhavatyaḥ (sc. ṛcaḥ) VāDh.23.39; 26.5; 28.11; ViDh.56.5; BDh.4.3.8; MDh.11.250; LAtDh.3.11; VAtDh.3.11; BṛhPDh.5.250; Rvidh.1.3.5.
ebhir matprattaiḥ svadhayā madadhvam # JG.2.1c.
emā agman revatīr jīvadhanyāḥ # RV.10.30.14a; AB.2.20.26; KB.12.2; Aś.5.1.19.
em enad adya vasavo rudrā ādityāḥ svadantu (KSṭB. sadantu) # MS.4.13.2: 200.9; KS.15.13; TB.3.6.2.1.
evā tvendro 'prativadhaṃ kṛṇotu # AVP.3.27.4d,6d.
evātharvā pitaraṃ viśvadevam # AVP.5.2.7a. See yo 'tharvāṇaṃ.
evā pitre viśvadevāya vṛṣṇe # RV.4.50.6a; AVś.20.88.6a; TS.1.8.22.2a; MS.4.11.2a: 166.9; 4.14.4: 220.5; KS.17.18a; AB.4.11.2; Aś.3.7.9; 5.18.5. P: evā pitre AB.3.30.4; TB.2.8.2.8; śś.8.3.15; 9.27.2; Mś.5.1.6.36; 5.1.9.24.
eṣa net tvad apacetayātai # VS.2.17d; KS.1.12d; śB.1.8.3.22d. See ned eṣa.
eṣā va ūrg eṣā vaḥ svadhā ca # JG.2.1a.
aiḍenauṣadhībhir (VSK. ailenau-) oṣadhīr jinva # VS.15.7; VSK.16.2.4. See revatauṣadhībhyā, and revad asi.
aindrāgnaś ca me vaiśvadevaś (VS. mahāvaiśvadevaś; MS. kṣullakavaiśvadevaś) ca me # VS.18.20; TS.4.7.7.2; MS.2.11.5: 143.5; KS.18.11.
aindrāgno dvādaśakapālaḥ # MS.1.10.1 (bis): 140.11; 141.2; KS.9.4.
aiṣu dhā vīravad yaśaḥ # RV.4.32.12c; 5.79.6a.
oṃ suvaḥ svadhā # BDh.2.10.17.38. Cf. svaḥ svāhā.
oṃ svadhā # GB.2.1.24; śB.2.6.1.24; Aś.2.19.18; Kś.5.9.11; Mś.1.7.6.32; AG.4.7.30. See ā svadhā, and astu svadhā.
oṃ svadhocyatām # AG.4.7.30. Cf. under astu svadheti.
ojiṣṭham ugrā ni vadhiṣṭaṃ vajram # RV.4.41.4b.
omanvantaṃ cakrathuḥ saptavadhraye # RV.10.39.9d.
oṃ bhuvaḥ svadhā # BDh.2.10.17.38. Cf. bhuvaḥ svāhā.
oṃ bhūḥ svadhā # BDh.2.10.17.38. Cf. bhūḥ svāhā.
oṣadhayaḥ saṃ vadante (VS. sam avadanta) # RV.10.97.22a; VS.12.96a; VSK.13.6.23a; TS.4.2.6.5a.
oṣadhayaḥ sam avadanta # see prec. but two.
oṣadhībhyas tvādbhyaḥ # KS.30.5 (bis).
oṣṭhāv iva madhv āsne vadantā # RV.2.39.6a.
aulūkhalān udvādayata # śB.4.3.3.19; Kś.10.3.11.
aulūkhalāḥ saṃpravadanti grāvāṇaḥ # SMB.2.2.13a. See prec. but one, ulūkhalā, and vānaspatyā grāvāṇo.
kaṇvā adantu nir ito vadhena # AVP.1.86.1d.
kadā naḥ śuśravad gira indro aṅga # RV.1.84.8c; AVś.20.63.5c; SV.2.693c; N.5.17c.
kayā yāti svadhayā ko dadarśa # RV.4.13.5c; 14.5c.
kavir devo (AVP. devān) na dabhāya svadhāvān (AVP. svadhāvaḥ) # AVś.4.1.7d; AVP.5.2.7d.
kaśā hasteṣu yad vadān (JB. yād vādān) # RV.1.37.3b; SV.1.135b; JB.3.277b.
kāṭe nibāḍha (AVP. nivāḍha) ṛṣir ahvad ūtaye # RV.1.106.6b; AVP.4.28.6b.
kāmakāmāya svāhā # VāDh.23.3.
kāmāya svāhā # KS.37.15,16; JB.1.362 (bis); TB.3.1.4.15; 5.4,15; 12.2.3; TA.2.18.1 (bis); Tā.10.61.1; 67.2; MahānU.18.2; 19.2; AG.4.3.26; Kauś.81.31; PG.3.12.9 (bis); JG.1.4; BDh.2.1.1.34 (bis); 4.2.10 (bis); GDh.25.4 (bis); VāDh.23.3. Cf. agnaye kāmāya svāhā.
kām u svadhām ṛṇavaḥ śasyamānaḥ # RV.7.8.3b.
kiṃ sa ṛdhak kṛṇavad yaṃ sahasram # RV.4.18.4a.
kiṃ te pākaḥ kṛṇavad apracetāḥ # RV.10.7.6b.
kiṃ nūnam asmān kṛṇavad arātiḥ # RV.8.48.3c; Kś.10.9.7c; Mś.2.5.4.40c; śirasU.3c. See kim asmān kṛ-.
kim asmān kṛṇavad arātiḥ # TS.3.2.5.4c. See kiṃ nūnam.
kiyatī yoṣā maryato vadhūyoḥ # RV.10.27.12a.
kulāyaṃ kṛṇavād iti # AVś.20.132.5; śś.12.18.13.
kuṣṭhaṃ tapanti marutaḥ svādhyanduraḥ # AVP.9.29.7a.
kūṣmāṇḍāḥ or kuṣmāṇḍāḥ (sc. mantrāḥ), kūṣmāṇḍāni or kuṣmāṇḍāni (sc. sūktāni), and kūṣmāṇḍyaḥ or kuṣmāṇḍyaḥ (sc. ṛcaḥ), also spelled kūśor kuś# GDh.19.12; 20.12; 22.36; 24.9; ViDh.56.7; 86.12; VāDh.22.9; 23.21; 28.11; BDh.1.10.19.16; 2.1.2.31; 3.7.1; 3.10.10; 4.3.8; 4.7.5; MDh.8.106; YDh.3.304; LAtDh.2.4; 3.11; VAtDh.2.4; 3.11; VHDh.8.270; śaṅkhaDh.10.2; 13.19; BṛhPDh.5.230,250; 7.33; 8.333; 9.22,246,274. Designations of series of expiatory mantras, such as yad devā devaheḍanam VS.20.14 ff.; vaiśvānarāya prativedayāmaḥ TA.2.6 ff.
kṛṇomi tubhyaṃ sahapatnyai vadhu # AVś.14.1.58d. See under ariṣṭāṃ tvā.
kṛtabrahmā śūśuvad rātahavya (MS. -vyā) it # RV.2.25.1b; MS.4.14.10b: 230.15; TB.2.8.5.2b.
kṛṣṇavyathir asvadayan na bhūma # RV.2.4.7d.
ketumad dundubhir vāvadīti (AVś.AVP. -tu) # RV.6.47.31b; AVś.6.126.3b; AVP.15.12.1b; VS.29.57b; TS.4.6.6.7b; MS.3.16.3b: 187.12; KSA.6.1b.
kena pary abhavad divam # AVś.10.2.18b.
ko asyā no druho 'vadyavatyāḥ # AVś.7.103.1a. P: ko asyā naḥ Kauś.59.19.
kratvā mahāṃ anuṣvadham # RV.1.81.4a; SV.1.423a.
krandad aśvo nayamāno ruvad gauḥ # RV.1.173.3c.
kravyādam agne mahatā vadhena # AVP.12.20.1c.
krośāya tūṇavadhmam # VS.30.19; TB.3.4.1.13.
kva syā vo marutaḥ svadhāsīt # RV.1.165.6a; MS.4.11.3a: 169.1; KS.9.18a; TB.2.8.3.5a.
kṣāmā ye viśvadhāyasaḥ # RV.10.176.1c.
kṣipreṣave devāya svadhāvne (TB. svadhāmne) # RV.7.46.1b; TB.2.8.6.8b; N.10.6b.
kṣudhaṃ sediṃ vadhaṃ bhayam # AVś.8.8.18b.
kṣubhā martam anuyataṃ vadhasnaiḥ # RV.5.41.13d.
kṣuro nāmāsi svadhitis te pitā # HG.1.9.10.
kṣetre cānṛtavādinam # AVP.9.19.2d.
kṣṇotreṇeva svadhitiṃ saṃ śiśītam # RV.2.39.7d.
khaḍgo (VS. erroneously, khaṅgo) vaiśvadevaḥ # VS.24.40; VSK.26.44; MS.3.14.21: 177.4.
gandhāribhyo mūjavadbhyaḥ # AVś.5.22.14a; AVP.12.2.2a.
garbhe dīrghatamā vadan # JB.3.239b.
garbhebhyo maghavā viśvadarśataḥ # RV.1.146.5d.
gāyatam # ApG.6.14.4. Cf. pra vadantu, vāṇaśabdaṃ, and vīṇā vadantu.
gāyatrī havyavāḍ asi # AVP.5.14.3a.
gāyatreṇa chandasāṅgirasvat (MS.KS. chandasā) pṛthivyāḥ sadhasthād agniṃ purīṣyam aṅgirasvad ā bhara (MS. bharā) # VS.11.9; MS.2.7.1: 74.13; KS.16.1; śB.6.3.1.38. See next but two.
gāva upāvatāvatam (SV. upa vadāvaṭe) # RV.8.72.12a; SV.1.117a; 2.952a; VS.33.19a,71a.
gāvo na yūtham upa yanti vadhrayaḥ # RV.8.46.30a.
giro yasminn anavadyāḥ samīcīḥ # RV.3.31.13c.
gurupatnīḥ svadhā namas tarpayāmi # BDh.2.5.10.2.
gurūn svadhā namas tarpayāmi # BDh.2.5.10.2.
guhā santaṃ subhaga viśvadarśatam # RV.5.8.3c; TS.3.3.11.2c; JB.1.64c; śB.12.4.4.2c; Mś.5.1.2.17c.
guhā hitam upa niṇig vadanti # RV.4.5.8b.
gṛṣṭiṃ dhenum adhijarāyuṃ svadhām # AVP.11.5.8a.
gṛhā naḥ santu sarvadā (PG. sarvataḥ) # AVP.3.26.6d; Apś.6.27.3d; PG.3.4.18d; HG.1.29.1d.
gopāya mā (VāDh. māṃ) śevadhis te (N. -dhiṣ ṭe; SaṃhitopaniṣadB. śreyase te) 'ham asmi # SaṃhitopaniṣadB.3d; VāDh.2.8b; ViDh.29.9b; N.2.4b. Cf. tavāham asmi tvaṃ.
gomad agne aśvavad bhūri puṣṭam # AVP.1.96.3c; KS.40.5c; Apś.16.34.4c. Cf. next but one.
gomad aśvavad upa saṃ nudeha # TB.3.1.1.8d.
gomad aśvāvad idam astu pra bhūma # ApMB.2.15.1d.
gomad aśvāvad rathavac ca rādhaḥ # RV.7.77.5d.
gomad aśvāvad rathavat suvīram # RV.5.57.7a. P: gomad aśvāvat śś.6.10.8.
gomad aśvāvad rathavad vyantaḥ # RV.7.27.5c.
gomad ū ṣu nāsatyā (VS. ṇāsatyā, followed, without fusion, by aśvāvad) # RV.2.41.7a; VS.20.81a; Aś.4.15.2. P: gomad ū ṣu śś.6.6.2.
gomad dhanavad aśvavat puruṣavad dhiraṇyavat suvīravat svāhā # Apś.6.29.1d.
gomad dhanavad aśvavad ūrjasvat # TB.3.7.9.9c; Apś.13.25.3c.
gomad dhiraṇyavad vasu # RV.7.94.9a; KS.4.15a; Kauś.5.2a.
gomāyavo 'vādiṣur ekasṛko 'vādīd abhimṛtāḥ smaḥ paridhiṃ naḥ kuru # Apś.9.12.4.
goṣv eti vivāvadat # AVś.9.4.11b.
gnās tvā devīr viśvadevyāvatīḥ (MS. -devyavatīḥ) pṛthivyāḥ sadhasthe aṅgirasvat pacantūkhe (TS. aṅgirasvac chrapayantūkhe; MS. aṅgirasvañ śrapayantūkhe) # VS.11.61; TS.4.1.6.2; MS.2.7.6: 81.12; 3.1.8: 10.6; KS.16.6; śB.6.5.4.7. P: gnās tvā TS.5.1.7.2; KS.19.7.
grahān somasya mimate dvādaśa # RV.10.114.5d.
grāvabhyo vācaṃ vadatā vadadbhyaḥ # RV.10.94.1b; N.9.9b.
grāvāṇaṃ bibhrat pra vadāty agre # RV.7.33.14b.
grāvāṇo yasyeṣiraṃ vadanti # RV.5.37.2c.
grāvā yatra vadati kārur ukthyaḥ # RV.1.83.6c; AVś.20.25.6c.
grāvāvādīd (AVP.Apś. grāvā vaded) abhi somasyāṃśum (AVP.Apś. -śunā) # AVP.1.96.2c; KS.40.5c; Apś.16.34.4c.
grāvāsy adhvarakṛd (KS. grāvādhvarakṛd) devebhyaḥ # TS.1.4.1.1; MS.1.3.3: 30.13; 4.5.4: 68.10; KS.3.10. Ps: grāvāsy adhvarakṛt Apś.12.9.2; grāvāsi Mś.2.3.3.2. See adhvarakṛtaṃ, and rāvāsi.
gharma madhumataḥ pitṛmato vājimato bṛhaspatimato viśvadevyāvataḥ # Vait.14.7.
ghṛtam agner vadhryaśvasya vardhanam # RV.10.69.2a.
ghṛtāt svādīyo madhunaś ca vocata # RV.8.24.20c; AVś.20.65.2c; AG.1.1.4c.
cakāra bhiṣajāti ca # AVP.2.10.2d. Cf. kṛṇavad bhiṣajā.
cakṣur upāvadhīś cakṣus tvā hāsyati # Apś.10.2.11.
caturdaṃṣṭrāṃ chyāvadataḥ # AVś.11.9.17a.
caturdhā reto abhavad vaśāyāḥ # AVś.10.10.29a.
caturdhā hy etasyāḥ pañca-pañcākṣarāṇi; ... etasyāḥ ṣaḍ-ṣaḍ akṣarāṇi; ... etasyāḥ sapta-saptākṣarāṇi; ... etasyā aṣṭā-aṣṭā akṣarāṇi; ... etasyā nava-navākṣarāṇi; ... etasyā daśa-daśākṣarāṇi; ... etasyā ekādaśaikādaśākṣarāṇi; ... etasyā dvādaśa-dvādaśākṣarāṇi # MS.1.11.10: 172.12--19; KS.14.4 (with tasyāḥ etc., for etasyāḥ etc. of MS., and only as far as ... tasyā nava-navākṣarāṇi).
catuṣṭomo abhavad (MS.KS. catuṣṭomam adadhād) yā turīyā # TS.4.3.11.2a; MS.2.13.10a: 160.7; KS.39.10a. See agnīṣomāv adadhur.
candramā vā asvapno vāyur anavadrāṇas tau pra padye tābhyāṃ namo 'stu tau mottarato gopāyetām # PG.3.4.17.
caran pakvam udumbaram # śś.15.19b. See caran svādum.
caran svādum udumbaram # AB.7.15.5b. See caran pakvam.
cared asya tāvad goṣu # AVś.12.4.27c.
cāru mādyeha vādaya # SMB.1.7.15d.
cāru saṃbhalo vadatu vācam etām # AVś.14.1.31d.
cittim acittiṃ (KS. ms. citim acitiṃ) cinavad (KS. -vo) vi vidvān # RV.4.2.11a; TS.5.5.4.4a; KS.40.5a. P: cittim acittim Apś.16.34.3,4.
chandasaḥ svād anuṣṭubhaḥ # KS.37.13b.
chandasyāṃ vācaṃ vadan # RV.9.113.6b.
chandāṃsi ca dadhata ādvādaśam # RV.10.114.6b.
chardir yacha maghavadbhyaś ca mahyaṃ ca # RV.6.46.9c; AVś.20.83.1c; SV.1.266c; KS.9.19c.
jagatyā sāmāni kavayo vadanti # GB.1.5.25d.
jaghāna vṛtraṃ svadhitir vaneva # RV.10.89.7a.
janayas tvāchinnapatrā devīr viśvadevyāvatīḥ (MS. -devyavatīḥ) pṛthivyāḥ sadhasthe aṅgirasvat pacantūkhe # VS.11.61; MS.2.7.6: 81.14; 3.1.8: 10.10; KS.16.6; śB.6.5.4.8. P: janayas tvāchinnapatrāḥ KS.19.7. See varūtrayo janayas.
janāya viśvadohasaḥ # RV.1.130.5g.
jane priyam iva śevadhim # AVP.12.2.2c. Cf. praiṣyaṃ janam.
janebhyaḥ kṛṇavad bhayam # AVP.3.40.3b.
jamadagniḥ kaśyapaḥ svādv etat # AVP.2.28.5a; 5.28.4c.
jarayantī vṛjanaṃ padvad īyate # RV.1.48.5c.
jāmyai dhuryaṃ patim erayethām # AVś.5.1.4d. Cf. jāmir vadharyuḥ.
jihvā me madhuvādinī # AVP.1.55.3b; 4.22.5b; HG.1.24.6b. Cf. MahānU.11.14.
jīva me yāvadāyuṣam # SMB.1.5.16d.
jīvo mṛtasya carati svadhābhiḥ # RV.1.164.30c; AVś.9.10.8c.
juṣṭām adya devebhyo vācam udyāsam (śś. vācaṃ vadiṣyāmi) # śB.1.5.1.18; śś.1.4.5; Apś.24.11.2.
juhuyāt sarvadā haviḥ # śG.1.10.8b.
juhve manuṣvad uparāsu vikṣu # RV.4.37.3c.
jaitraṃ kratuṃ rayimad vīravad yaśaḥ # RV.10.36.10c.
jñātipatnīḥ svadhā namas tarpayāmi # BDh.2.5.10.2.
jñātīn svadhā namas tarpayāmi # BDh.2.5.10.2.
jyotis tamaso vayunāvad asthāt # RV.4.51.1b.
ta u evādhipataya āsan # MS.2.8.6: 110.19. See ta evādhi-, and teṣām ādhi-.
ta evādhipataya āsan # VS.14.30; KS.17.5; śB.8.4.3.16. See under ta u evā-.
taṃ vā ahaṃ nārvāñcaṃ na parāñcaṃ na pratyañcaṃ satyenodareṇa tenainaṃ prāśiṣaṃ tayainam ajīgamam # AVś.11.3.42; ... pratyañcaṃ satye pratiṣṭhāya tayainaṃ etc. AVś.11.3.49; ... pratyañcaṃ saptaṛṣibhiḥ prāṇāpānais tair enaṃ etc. AVś.11.3.38; ... pratyañcaṃ samudreṇa vastinā tenainaṃ etc. AVś.11.3.43; ... pratyañcaṃ savituḥ prapadābhyāṃ tābhyām enaṃ etc. AVś.11.3.47; ... pratyañcaṃ sūryācandramasābhyām akṣībhyāṃ tābhyām enaṃ etc. AVś.11.3.34; ... pratyañcaṃ tvaṣṭur aṣṭhīvadbhyāṃ tābhyām enaṃ etc. AVś.11.3.45; ... pratyañcaṃ divā pṛṣṭhena tenainaṃ etc. AVś.11.3.40; ... pratyañcaṃ dyāvāpṛthivībhyāṃ śrotrābhyāṃ tābhyām enaṃ etc. AVś.11.3.33; ... pratyañcam agner jihvayā tayainaṃ etc. AVś.11.3.36; ... pratyañcam antarikṣeṇa vyacasā tenainaṃ etc. AVś.11.3.39; ... pratyañcam aśvinoḥ pādābhyāṃ tābhyām enaṃ etc. AVś.11.3.46; ... pratyañcam ṛtasya hastābhyāṃ tābhyām enaṃ etc. AVś.11.3.48; ... pratyañcam ṛtubhir dantais tair enaṃ etc. AVś.11.3.37; ... pratyañcaṃ pṛthivyorasā tenainaṃ etc. AVś.11.3.41; ... pratyañcaṃ bṛhaspatinā śīrṣṇā tenainaṃ etc. AVś.11.3.32; ... pratyañcaṃ brahmaṇā mukhena tenainaṃ etc. AVś.11.3.35; ... pratyañcaṃ mitrāvaruṇayor ūrubhyāṃ tābhyām enaṃ etc. AVś.11.3.44.
taṃ śiśītā svadhvaram # RV.8.40.11a.
taṃ svadhām akṣitaṃ taiḥ sahopajīvāsau # HG.2.13.1 (ter). See tāṃ tvaṃ svadhāṃ.
takmānaṃ viśvadhāvīrya (AVP.12.1.4c, -vīryā followed by a-) # AVś.5.22.3c; 19.39.10c; AVP.7.10.10c; 12.1.4c.
takṣan pitṛbhyām ṛbhavo yuvad vayaḥ # RV.1.111.1c.
tato yajñas tāyate viśvadānīm # KS.31.14d; Mś.1.2.4.5d. See tato yajño.
tato yajño jāyate viśvadāniḥ # TB.3.3.9.10d; Apś.2.1.3d. See tato yajñas.
tat kṛṇve 'ham udaraṃ śevadhibhyaḥ # AVś.9.3.15d.
tat te rukmo na rocata svadhāvaḥ # RV.4.10.6d; TS.2.2.12.7d; MS.4.12.4d: 190.5.
tat prajāvad apatyavat # AVś.12.4.1d.
tatra tvādityau rakṣatām # AVś.8.2.15d.
tatra tvādur gārhapatyāya devāḥ # AVP.4.10.4c.
tathā tvāchāvadāmasi # AVP.3.29.1d. See tāṃ tvāchā-.
tathaiva tān na bhunakti śrutaṃ tat # VāDh.2.11d; N.2.4d.
tad ajānād vadhūḥ satī # AVś.11.8.17b.
tad asmai navyam aṅgirasvad arcata # RV.2.17.1a. P: tad asmai navyam Aś.6.4.10; śś.9.13.3.
tad id vadanty adrayo vimocane # RV.10.94.13a.
tad id vadanty arthinaḥ # AVP.9.10.5a.
tad ud vapati gām avim # VS.12.71c; śB.7.2.2.11; VāDh.2.34c. See under ud it kṛṣati.
tad dūre tad v (īśāU. tadvad) antike # VS.40.5b; īśāU.5b.
taṃ tvādadhur brahmaṇe bhāgam agre # Vait.6.1c.
taṃ no agne maghavadbhyaḥ purukṣum # RV.7.5.9a.
tan me astu svadhā namaḥ # HG.2.15.9d.
tapas teja svadhāmṛtam # JB.3.373c.
tapurmaghāya namo 'stu takmane # AVP.12.1.2d. See tapurvadhāya.
tapo navadaśaḥ # VS.14.23; TS.4.3.8.1; 5.3.3.3; MS.2.8.4: 109.3; KS.17.4; 20.13; śB.8.4.1.14.
tam u tvaṃ māyayāvadhīḥ # RV.1.80.7d. See tava tyan mā-.
tamo vyasya pra vadāsi valgu # AVś.12.3.18b.
taṃ manyeta pitaraṃ mātaraṃ ca # SaṃhitopaniṣadB.3c; VāDh.2.10c; N.2.4c. Cf. Mahābh.1.76.63. See taṃ vai manye.
tayā devatayāṅgirasvad dhruvaḥ sīda # VS.27.45; śB.8.1.4.8; TA.4.19.1.
tayā devatayāṅgirasvad dhruvā sīda # VS.12.53 (bis); 13.19,24; 14.12,14; 15.58; TS.4.2.4.4 (bis); 9.2; 3.6.2; 4.3.3; 5.5.2.4 (bis); 5.4; 6.3; MS.2.7.11: 90.3 (bis); 2.7.15 (bis): 98.1,4; 2.7.16 (quinq.): 99.5,7,9,12,15; 2.8.7: 111.12; 2.8.14 (ter): 117.9,12,14; 2.13.14 (bis): 163.7,14; 2.13.20 (bis): 165.13; 166.11; KS.16.11 (bis),16; 38.13; 39.3 (ter),4 (ter); 40.3 (ter),5; śB.6.1.2.28; 7.1.1.30 (bis); TB.3.10.2.1 (quater); 11.1.1--21; 6.2 (bis); 12.6.6; TA.4.17.1; 18.1; Apś.6.9.4; 16.11.4; 21.6; 23.10 (bis); 17.25.1; 19.11.7; Mś.6.1.5.34. P: tayā devatayā TA.6.6.2; 7.3 (bis); 8.1 (bis); Kś.16.7.14; Mś.6.1.5.5. See tayādevatam, tena chandasā, tena brahmaṇā, tenarṣiṇā, and cf. śB.10.5.1.3.
tayā devatayāṅgirasvad dhruvāḥ sīdata # TS.4.2.7.4.
tayā devatayāṅgirasvad dhruve sīdatam # VS.13.25; 14.6; 15.64. Cf. Mś.6.1.8.
tayā prattaṃ svadhayā madantu # HG.2.11.1d. See tvayā etc., and mayā prattaṃ.
tayor anyaḥ pippalaṃ svādv atti # RV.1.164.20c; AVś.9.9.20c; MuṇḍU.3.1.1c; N.14.30c.
taraṇir viśvadarśataḥ # RV.1.50.4a; AVś.13.2.19a; 20.47.16a; ArS.5.9a; VS.33.36a; TS.1.4.31.1a; MS.4.10.6a: 158.12; 4.12.4: 190.12; KS.10.13a; TA.3.16.1a; MahānU.20.7a; Aś.9.8.3; śś.3.18.6; Apś.16.12.1. P: taraṇiḥ Apś.12.15.10.
tarat sa mandī dhāvati # RV.9.58.1a,1c,2c,3c,4c; SV.1.500a,500c; 2.407a,407c,408c,409c,410c; JB.2.272; JG.1.13; N.13.6a,6c; BṛhPDh.2.137. Designations of the hymn and its stanzas: tarat-samandī GDh.24.2; Svidh.2.1.7; tarat-sa-mandīya BDh.2.3.5.8; 4.2.5; ViDh.56.6; MDh.11.254; Rvidh.3.2.2; 3.4; tarat-sa-mandyaḥ GDh.20.12; BDh.4.2.4; tarat-samāḥ VāDh.28.11; BDh.4.3.8; LAtDh.3.11; VAtDh.3.11; BṛhPDh.5.250.
tarasāṃ cakṣur abhavad vaśā # AVś.10.10.24d.
tava tyan māyayāvadhīḥ # SV.1.412d. See tam u tvaṃ mā-.
tava svadhāva iyam ā samarye # RV.1.63.6c.
tava svādiṣṭha te pito # RV.1.187.5b; AVP.6.16.5b; KS.40.8b.
tava svādiṣṭhāgne saṃdṛṣṭiḥ # RV.4.10.5a.
tavāham asmi tvaṃ mā pālayasva # SaṃhitopaniṣadB.3b. See gopāya mā śevadhiṣ.
tavāhim avasāvadhīt # RV.1.187.6d; AVP.6.16.6d; KS.40.8d.
tastambha viśvadhā yatīḥ # AVś.6.85.3b.
tasmā āyuḥ prajāvad it # RV.1.132.5d.
tasmā iḍā pinvate viśvadānīm (TB. -dānī) # RV.4.50.8b; TB.2.4.6.4b; AB.8.26.7.
tasmā u havyaṃ ghṛtavad vidhema (śś.śG. -vaj juhota) # TS.3.3.11.3d; śś.9.28.3d; śG.1.22.7d; ApMB.2.11.2d. See dhātra id.
tasmāc chamaḥ paramaṃ vadanti # TA.10.63.1e; MahānU.22.1e.
tasmāt tapaḥ paramaṃ vadanti # TA.10.63.1e; MahānU.22.1e.
tasmāt prajananaṃ paramaṃ vadanti # TA.10.63.1; MahānU.22.1.
tasmāt satyaṃ paramaṃ vadanti # TA.10.63.1e; MahānU.22.1e.
tasmād agnihotraṃ paramaṃ vadanti # TA.10.63.1; MahānU.22.1.
tasmād agnīn paramaṃ vadanti # TA.10.63.1; MahānU.22.1.
tasmād eṣābhavad vaśā # AVP.12.10.6d.
tasmād damaḥ paramaṃ vadanti # TA.10.63.1e; MahānU.22.1e.
tasmād dānaṃ paramaṃ vadanti # TA.10.63.1f; MahānU.22.1f.
tasmād dharmaṃ paramaṃ vadanti # TA.10.63.1e; MahānU.22.1e.
tasminn induḥ pavate viśvadānīm # AVś.18.3.54d.
tasmai na druhyet katamac canāha (ViDh. druhyet kṛtam asya jānan) # SaṃhitopaniṣadB.3d; ViDh.30.47d; VāDh.2.10d; N.2.4d.
tasmai mā brūyā nidhipāya brahman # VāDh.2.9d; ViDh.29.10d; N.2.4d.
tasya te padvad dhavirdhānam # MS.4.9.11: 131.11; TA.4.11.5.
tasya te vayaṃ svadhayā madema # TS.5.7.24.1d; KSA.5.16d.
tasya yad āhuḥ pippalaṃ svādv agre # AVś.9.9.21c. See tasyed āhuḥ.
tasyāḥ pīvo abhavad varmavāsasam # AVP.12.9.8d.
tasyā garbho abhavad viśvarūpaḥ # AVś.9.1.5b.
tasyās te viśvadhāyasaḥ # AVP.3.15.1c--4c; 6.7.4c--6c.
tasyed āhuḥ pippalaṃ svādv agre # RV.1.164.22c. See tasya yad āhuḥ.
tasyai prajāpatir ajuhot svādhiṣṭhānā ceti svādhicaraṇa ceti # AVP.13.9.1.
tasyora iyam abhavad dyauḥ pṛṣṭham # AVś.9.5.20b.
tā aśvadā aśnavat somasutvā # RV.1.113.18d.
tā īm ā kṣeti svadhayā madantīḥ # RV.10.124.8b.
tāṃ viśvarūpāḥ paśavo vadanti # RV.8.100.11b; TB.2.4.6.10b; PG.1.19.2b; N.11.29b.
tāṃ gandharvo 'vadad garbhe antaḥ # RV.10.177.2b; TA.3.11.11b; JUB.3.36.1b.
tā jīvalā jīvadhanyāḥ pratiṣṭhāḥ # AVś.12.3.25c.
tā no yajñam āgataṃ viśvadhenā # MS.4.14.6c: 223.2; TB.2.8.4.4c.
tāṃ tvaṃ svadhāṃ tais sahopa jīva # ApMB.2.19.14--16. See taṃ svadhām.
tāṃ tvāchāvadāmasi # AVś.7.38.3d. See tathā tvāchā-.
tāṃ naḥ svādvīṃ bhūtapatiḥ kṛṇotu # AVP.12.9.3d,4d.
tābhyāṃ tvādadhe # MS.1.6.1: 86.2.
tām ito nir avādiṣam # AVś.4.6.2d; AVP.5.8.1d.
tām airayaṃś candramasi svadhābhiḥ # MS.1.1.10c: 6.10; KS.1.9c. See yām etc.
tāṃ mābhy ava gā dvādaśāhnāni vi rakṣe # AVP.15.23.1.
tā yaṃsato maghavadbhyo dhruvaṃ yaśaḥ # RV.7.74.5c.
tā yā devā devadānāny adus tāny asmā ā ca śāsvā (VS. śāssvā) ca gurasva # VS.21.61; 28.23,46; MS.4.13.9: 211.10; KS.19.13; TB.2.6.15.2; 3.6.15.1.
tāvad vai brahmavarcasam # VāDh.1.15d.
tās tvādṛśī brahmāṇaṃ sūdayanti # AVP.6.3.12a.
tās tvā vadhu prajāvatīm # AVś.14.2.7c. See te tvā vadhu.
tāsv adhvaryav ādhāvendrāya somam ūrjasvantaṃ payasvantaṃ madhumantaṃ vṛṣṭivaniṃ vasumate rudravata ādityavata ṛbhumate vibhumate vājavate bṛhaspatimate viśvadevyāvate # śś.6.7.10. See next.
tāsv adhvaryo indrāya somaṃ sotā madhumantaṃ vṛṣṭivaniṃ tīvrāntaṃ bahuramadhyaṃ vasumate rudravata ādityavata ṛbhumate vibhumate vājavate bṛhaspativate viśvadevyāvate # AB.2.20.14; Aś.5.1.15. See prec.
tilamiśrāḥ svadhāvatīḥ # AVś.18.3.69b; 4.26b,43b.
tiṣṭhanti svādurātayaḥ # RV.8.68.14c.
tisraḥ śilpā vaśā vaiśvadevyaḥ # TS.5.6.13.1; KSA.9.3.
tisro devīḥ svadhayā barhir edam # RV.2.3.8c.
tisro vācaḥ pra vada jyotiragrāḥ # RV.7.101.1a. Cf. BṛhD.6.25; Rvidh.2.30.1. Cf. tisraḥ prajā.
tubhyaṃ kanyām alaṃkṛtām # VāDh.17.17b.
turīyaṃ vāco manuṣyā vadanti # RV.1.164.45d; AVś.9.10.27d; śB.4.1.3.17d; TB.2.8.8.6d; JUB.1.7.3d; 40.1d; N.13.9d.
turyavāhaṃ gāṃ vayo dadhat # VS.28.28f; TB.2.6.17.4f. Cf. turyavāḍ gaur.
tṛtīyasya savanasya ṛbhumato vibhumato vājavato bṛhaspatimato (Mś. -vato) viśvadevyāvatas tīvrā3ṃ (Mś. tīvraṃ) āśīrvata indrāya somān prasthitān preṣya # Kś.10.5.9; Mś.2.5.1.32. See next.
tṛtīyasya savanasyarbhumato vibhumataḥ prabhumato vājavataḥ savitṛvato bṛhaspativato viśvadevyāvatas tīvrāṃ āśīrvata indrāya somān # Apś.13.12.2. See prec.
te asyai vadhvai saṃpatnyai # AVś.14.2.73c.
te ghed agne svādhyaḥ # RV.8.19.17a; 43.30a.
tejasvad astu me mukham # TB.2.7.7.3a; Apś.22.26.3. Cf. varcasvad etc.
te te santu svadhāvantaḥ # AVś.18.3.68c; 4.25c,42c.
te tvā madā bṛhad indra svadhāvaḥ # RV.6.17.4a.
te tvā vadhu prajāvatīm # ApMB.1.7.9c. See tās tvā vadhu.
te devā asapatnam imaṃ suvadhvam amum āmuṣyāyaṇam amuṣyāḥ putram amuṣyāṃ viśi mahate kṣatrāya mahate jānarājyāya # MS.2.6.6: 67.12; amum āmuṣyāyaṇam ... mahate jānarājyāya (with the first part of the formula understood) Mś.9.1.2.24. See next, and ye devā devasuva.
te devā asapatnam imaṃ suvadhvaṃ mahate kṣatrāya mahate jyaiṣṭhyāya mahate rājyāya mahate jānarājyāya mahate viśvasya bhuvanasyādhipatyāya # KS.15.5. See under prec.
tena chandasā tena brahmaṇā tayā devatayāṅgirasvad dhruvā sīda # MS.2.13.14 (bis): 163.7,14; 2.13.20 (bis): 165.13; 166.11. Fragments (with ūha): dhruvāḥ sīdata Mś.6.1.8.2; dhruve sīdatam Mś.6.1.8.8. See tena brahmaṇā, tenarṣiṇā, and cf. tayā devatayāṅgirasvad.
tena te 'vadhiṣaṃ (AVP. te vadhiṣaṃ) haviḥ # AVś.7.70.4d,5d; AVP.13.2.6d. See sarvaṃ te 'vadhiṣaṃ.
tena tvāchāvadāmasi # AVP.15.15.4d.
tena no rāddhim āvada # Lś.4.2.2d.
tena brahmaṇā tena chandasā tayā devatayāṅgirasvad dhruvāḥ sīdata (KS.39.1,7, dhruvā sīda) # KS.39.1,4,7,13. See under tena chandasā.
tena me tapa, tena me jvala, tena me dīdihi, yāvad devāḥ, yāvad asāti sūryaḥ, yāvad utāpi brahma # TB.3.10.3.1.
tena me viśvadhāvīrya # AVP.1.43.3c.
tenarṣiṇā (Aś. tena ṛṣiṇā; MS. tena ṛṣiṇā tena vidhinā tena chandasā) tena brahmaṇā tayā devatayāṅgirasvad dhruvā sīda # TS.4.4.6.2; MS.4.9.15: 134.12; 4.9.16: 135.3; TB.3.12.6.1,6; 7.1,5; 8.1,3; Aś.2.3.25; Apś.16.28.1 (bis). See tena chandasā, tena brahmaṇā, and cf. tayā devatayāṅgirasvad.
tenāyaṃ kṛṇavad vīryāṇi # AVś.19.27.10d; AVP.10.7.10d.
tebhyas tvaṃ dhukṣva sarvadā # AVś.10.9.12d.
tebhyaḥ sarvebhyaḥ sapatnīkebhyaḥ svadhāvad akṣayyam astu # Kauś.88.13.
te 'rātiṃ ghnantu sarvadā # AVP.5.26.7d.
te 'vadan prathamā brahmakilbiṣe # RV.10.109.1a; AVś.5.17.1a; AVP.9.15.1a. P: te 'vadan Kauś.48.11. Cf. BṛhD.8.36.
te vācaṃ vādiṣur mottarāṃ mat # AVś.6.118.3c.
te śuṣyantv apa dāvād iva # AVP.12.5.8c.
teṣāṃ lokaḥ svadhā namaḥ # VS.19.45c; MS.3.11.10c: 156.12; KS.38.2c; śB.12.8.1.19c; TB.2.6.3.4c; Apś.1.9.12c; śG.5.9.4c.
teṣu cāru vadema te # AVś.12.1.56d.
te saubhagaṃ vīravad gomad apnaḥ # RV.10.36.13c; MS.4.14.11c: 232.9; TB.2.8.6.4c.
tmanam ūrjaṃ na viśvadha kṣaradhyai # RV.1.63.8d.
tyaṃ cid eṣāṃ svadhayā madantam # RV.5.32.4a.
trayaḥ pṛśnayaḥ sarvadevatyāḥ # TS.5.6.20.1; KSA.9.10.
trayodaśena dvādaśopamāsaḥ # JB.1.50b. See dvādaśena trayodaśopamāsaḥ.
trātāram indram akṛṇor avadhyam (VSK. ayudhyam) # VS.8.46b; 17.24b; VSK.8.21.1b; 18.2.9b; TS.4.6.2.6b; MS.2.10.2b: 133.14; KS.18.2b; śB.4.6.4.6b. See hantāram indram.
trāyadhvaṃ no aghaviṣābhyo vadhāt # AVś.6.93.3a.
trir jāto viśvadevebhyaḥ # AVś.19.39.5c; AVP.7.10.5c.
trivṛn no viṣṭhayā (KS. trivṛd viṣṭhayā) stomo ahnām (MS. ahnā) # TS.4.4.12.1c; MS.3.16.4c: 188.1; KS.22.14c; Aś.4.12.2c. Cf. dvādaśā iṣṭayā.
triṣaptāso marutaḥ svādusaṃmudaḥ # AVś.13.1.3d. See trisaptāso.
trisaptāso marutaḥ svādusaṃmudaḥ # TB.2.5.2.3d. See triṣaptāso.
trīṇy ahaś caikaṃ tāvad asya # GB.1.5.23b.
tretāyā ādinavadarśam # TB.3.4.1.16. See next but one.
traividyavṛddhā yaṃ brūyuḥ # VāDh.1.16a.
tvaṃ śuṣṇasyāvatiro vadhatraiḥ # RV.8.96.17c; AVś.20.137.11c.
tvaṃ soma pra cikito manīṣā # RV.1.91.1a; VS.19.52a; TS.2.6.12.1a; MS.4.10.6a: 156.6; KS.21.14a; AB.1.9.7; TB.2.6.16.1; Aś.2.19.22; 3.7.7; 4.3.2. P: tvaṃ soma pra cikitaḥ śś.3.16.4; 5.5.2; 6.10.3; Apś.8.15.15; 19.3.9; Mś.5.2.4.31. Designated as durgā or durgāsāvitrī ViDh.56.9; VāDh.28.11; BDh.4.3.8; LAtDh.3.11; VAtDh.3.11. Cf. BṛhD.3.124.
tvaṃ hi kṣaitavad yaśaḥ # RV.6.2.1a; SV.1.84a; KB.20.3; 22.2; 25.3. P: tvaṃ hi kṣaitavat Aś.4.13.7; 10.2.5; śś.6.4.3; 10.3.3; 11.13.18; 15.3.
tvaṃ hi havyavāḍ asi # RV.5.28.5c; TB.3.5.2.3c; śB.1.4.1.39.
tvaṃ hy aṅga varuṇa svadhāvan (AVP. -vaḥ) # AVś.5.11.5a; AVP.8.1.5a.
tvaṃ karañjam uta parṇayaṃ vadhīḥ # RV.1.53.8a; AVś.20.21.8a.
tvacaṃ pavitraṃ kṛṇuta svadhāvān # RV.10.31.8c.
tvacaṃ mṛtyor juhomi tvacā mṛtyuṃ vāsaye # VāDh.20.26. Cf. GDh.24.6.
tvaj jātā rudra śaṃtamā # AVP.15.20.1a. See tvādattebhī.
tvad ayaṃ jāyatāṃ punaḥ # VS.35.22b; śB.12.5.2.15b; TA.6.2.1b; Kś.25.7.38b; Karmap.3.2.13b. See ayaṃ tvad.
tvaṃ deva maghavadbhyaḥ suṣūdaḥ # RV.7.1.20b.
tvaṃ nṛbhir dakṣiṇāvadbhir agne # RV.10.69.8c.
tvaṃ nṛbhir havyo viśvadhāsi # RV.7.22.7c; AVś.20.73.1c.
tvam agne vīravad yaśaḥ # RV.7.15.12a; MS.4.10.1a: 143.1; śś.2.4.7. P: tvam agne vīravat Mś.5.1.1.34.
tvam asmākam indra viśvadha syāḥ # RV.1.174.10a.
tvam u naḥ sahasāvann avadyāt # RV.6.15.12b.
tvaṃ bhavādhipatir janānām # MS.4.12.2b: 181.13; KS.8.17b. See tvaṃ bhūr.
tvaṃ bhūr abhibhūtir janānām # AVś.6.98.2b. See tvaṃ bhavādhipatir.
tvaṃ mahīm avaniṃ viśvadhenām # RV.4.19.6a.
tvaṃ māyābhir anavadya māyinam # RV.10.147.2a.
tvayā prattaṃ svadhayā madanti # ApMB.2.19.7d. See under tayā etc.
tvayā martāsaḥ svadanta āsutim # RV.2.1.14c.
tvayāyaṃ vṛtraṃ vadhyāt (VS.śB. badhet; VSK. badhyāt) # VS.10.8; VSK.11.4.4; TS.1.7.7.1; 8.12.3; 15.1; MS.2.6.9: 69.8; 4.4.3: 53.9; KS.15.7; śB.5.3.5.28. P: tvayāyam Kś.15.5.19.
tvayā yajño jāyate viśvadāniḥ # TB.3.7.4.12b; Apś.1.6.4b.
tvaṣṭā gnābhiḥ sajoṣā jūjuvad ratham # RV.2.31.4b.
tvaṣṭreva rūpaṃ sukṛtaṃ svadhityā # AVś.12.3.33c.
tvāṃ soma pavamānaṃ svādhyaḥ # RV.9.86.24a.
tvādūtāso manuvad vadema # RV.2.10.6b.
tvām agne dharṇasiṃ viśvadhā vayam # RV.5.8.4a.
tvām agne vadhryaśvaḥ saparyan # RV.10.69.10b.
tvām agne svādhyaḥ # RV.6.16.7a.
tvāmāhutayas tvadvivācanāḥ # TS.1.5.10.2b.
tvām eva pratyakṣaṃ brahma vadiṣyāmi (TA.7.12.1; TU.1.12.1, brahmāvādiṣam) # TA.7.1.1; 12.1; TU.1.1.1; 12.1.
tvāvṛdho maghavan dāśvadhvaraḥ # RV.10.147.4c.
tviṣīmān viśa ā vada # AVP.10.3.7d.
tveṣaṃ vaco apāvadhīt (TSṭB. apāvadhīṃ; MS. apāvadhīḥ) svāhā # VS.5.8d (ter); TS.1.2.11.2; MS.1.2.7c: 17.5; KS.2.8 (bis); śB.3.4.4.23d--25d; TB.1.5.9.5,6.
tsarau parṇam ivā dhām (AVP.12.3.2d, ivādhām) # AVP.3.39.5d; 12.3.2d. See sarau parṇam.
dakṣiṇāṃ sūryām aditiṃ vadanti # AVP.12.9.2a.
dakṣiṇāyāṃ tvā diśi purā saṃvṛtaḥ svadhāyām ā dadhāmi # AVś.18.3.31a.
dattaḥ śitipāt svadhā # AVś.3.29.1e.
dadānīty agnir vadati # Aś.5.13.14a. See dadāmīty etc.
dadāmīty agnir vadati # TB.2.4.6.7a. See dadānīty.
dadhāti ratnaṃ svadhayor apīcyam # RV.9.86.10c; SV.2.381c; JB.3.135; Apś.20.13.4c; Mś.9.2.3.7c.
dadhāno gomad aśvavad suvīryam # RV.8.46.5a.
damena dāntāḥ kilbiṣam avadhūnvanti # TA.10.63.1a; MahānU.22.1a.
darśaṃ nu viśvadarśatam # RV.1.25.18a.
daśa svadhābhir adhi sāno avye # RV.9.92.4c. Cf. daśa svasāro adhi.
daśa svasāro adhi sāno avye # RV.9.91.1c; SV.1.543c. Cf. daśa svadhābhir.
daśāhaṃ prācīs tad ṛtaṃ vadāmi # RV.10.34.12d.
dahaty agnir yathā kakṣam # VāDh.2.12a. See agnir iva kakṣaṃ.
dārv aṅgaiṣo apāvadhīt # RV.10.146.4b; TB.2.5.5.7b.
dāsaḥ śevadhipā ariḥ # RV.8.51 (Vāl.3).9b; SV.2.959b; VS.33.82b.
dāsā yad īṃ susamubdham avādhuḥ # RV.1.158.5b.
ditiṃ ca rāsvāditim uruṣya # RV.4.2.11d; TS.5.5.4.4d; KS.40.5d.
dityavāhaṃ gāṃ vayo dadhat # VS.28.25e; TB.2.6.17.2f. Cf. dityavāḍ gaur.
divas pathā vadhvo yanty acha # RV.5.47.6d.
diviṣṭambhena (AVP. divi ṣṭambhena, so also mss. of AVś.) śaśvad it # AVś.19.32.7b; AVP.11.12.7b.
dive-diva īḍyo jāgṛvadbhiḥ # RV.3.29.2c; SV.1.79c; KU.2.4.8c.
divo jyote (KS.9.3, jyotir) vivasva āditya te no devā deveṣu satyāṃ devahūtim āsuvadhvam # KS.8.14; 9.3. See under devajūte vivasvann.
divo vā pārthivād adhi # RV.1.6.10b; AVś.20.70.6b.
diśāṃ patir abhavad vājinīvān # TB.2.8.4.2b. See viśāṃ etc.
dīdetha viśvadarśataḥ # RV.1.44.10b.
dundubher vācaṃ prayatāṃ vadantīm # AVś.5.20.5a; AVP.9.27.5a.
dundubhau yac ca vādyam # Lś.4.2.2c.
durmarṣaṃ sākaṃ (SV.JB. vāṇaṃ) pra vadanti vāṇam (SV.JB. sākam) # RV.9.97.8d; SV.2.467d; JB.3.174.
duhe no kumbhī svadhāṃ pitṛbhyaḥ # VS.19.87d; MS.3.11.9d: 154.1; KS.38.3d; TB.2.6.4.4d.
dūto na gantv aśvinā huvadhyai # RV.5.43.8b.
dūto havyavāḍ amūra (MS. -rā) upemaṃ yajñam upemāṃ devo devahūtim avatu (KS. omits avatu) # MS.4.13.2: 200.7; KS.15.13; TB.3.6.2.1.
dūṣyās tvāvadhaṃ bhayam # AVP.7.5.11a.
dṛḍho nakṣatra uta viśvadevaḥ # RV.6.67.6c.
dṛṣadaṃ jihvayāvadhīt # RV.8.72.4c.
devakṛtasyainaso 'vayajanam asi (TāṃahānU.Aś.Vait.BDh. asi svāhā) # VS.8.13; TS.3.2.5.7; PB.1.6.10; Tā.10.59; MahānU.18.1; Aś.6.12.3; śś.8.9.1; Vait.23.12; Apś.13.17.9; Mś.2.5.4.8; BDh.4.3.6. P: devakṛtasya Lś.2.11.14; Kś.10.8.6; GDh.25.10; 27.7; VyāsaDh.3.29. Designated as devakṛtam ViDh.56.4; VāDh.28.11; BDh.4.3.8; as śākala-homīya-mantrāḥ MDh.11.201,257.
devajūte vivasvann āditya te no devāḥ satyāṃ devahūtiṃ deveṣv āsuvadhvam # MS.1.7.1: 110.5; 1.7.5: 114.8. See divo jyote, and vivasvāṃ aditir.
deva barhiḥ svāsasthaṃ tvādhyāsadeyam # Aś.1.4.7. Cf. māmṛṣad.
devasya tvā savituḥ prasave 'śvinor bāhubhyāṃ pūṣṇo hastābhyāṃ rakṣaso vadhaṃ juhomi # TS.1.8.7.2. P: devasya tvā prasave TB.1.7.1.9. Fragmentary: devasya tvā ... rakṣaso vadhaṃ juhomi Apś.18.9.17.
devasya tvā savituḥ prasave 'śvinor bāhubhyāṃ pūṣṇo hastābhyām ā dade dviṣato vadhāya # ApMB.2.9.5 (ApG.5.12.11). Cf. TS.2.6.4.1.
deva svadhāvo-mṛtasya nāma # RV.3.20.3b; TS.3.1.11.6b; MS.2.13.11b: 162.3.
devaḥ svadhāvo guhyaṃ bibharṣi # VārG.16.7b. See nāma svadhāvan etc.
devahitiṃ jugupur dvādaśasya # RV.7.103.9a.
devā etasyām avadanta pūrve # RV.10.109.4a; AVP.9.15.6a. See devā vā.
devā grāvāṇo madhumatīm adyāsmin yajñe yajamānāya vācaṃ vadata # PB.21.10.17; Kś.23.3.1; Apś.22.19.1; Mś.9.4.2.9.
devānāṃ tvā patnīr devīr viśvadevyavatīḥ pṛthivyāḥ sadhasthe aṅgirasvad dadhatu mahāvīrān # MS.4.9.1: 121.12.
devānāṃ tvā patnīr devīr viśvadevyāvatīḥ (MS. -devya-) pṛthivyāḥ sadhasthe aṅgirasvad (TS. 'ṅg-) dadhatūkhe # VS.11.61; TS.4.1.6.1,2; MS.2.7.6: 81.10; 3.1.8: 10.1; KS.16.6; śB.6.5.4.4. Ps: devānāṃ tvā patnīḥ TS.5.1.7.1; KS.19.7; Apś.16.5.8; Mś.6.1.2.16; devānāṃ tvā Kś.16.4.11.
devānāṃ brahmavādaṃ vadatāṃ yat # TB.1.2.1.6a; Apś.5.2.4a.
devān yakṣi svadhvara # RV.5.28.5b; śB.1.4.1.39; TB.3.5.2.3b.
devā vaśāṃ paryavadan # AVś.12.4.49a.
devā vā etasyām avadanta pūrve # AVś.5.17.6a. See devā etasyām.
devāso viśvadhāyasaḥ # AVś.3.22.2c; AVP.3.18.2c.
devī joṣṭrī vasudhitī yayor anyāghā dveṣāṃsi yūyavad ānyā vakṣad vasu vāryāṇi yajamānāya # MS.4.13.8: 210.1; KS.19.13; TB.3.6.13.1; N.9.42.
devebhyo havyavāḍ asi # Apś.16.11.11c.
devo dadau martyāya svadhāvān # RV.4.5.2b.
devo deveṣv anavadya jāgṛviḥ # RV.1.31.9b.
devo na yaḥ pṛthivīṃ viśvadhāyāḥ # RV.1.73.3a.
devy adite svādityam adyāsmin yajñe yajamānāyāsuvasva (Apś. adite 'nv adyemaṃ yajñaṃ yajamānāyaidhi) # PB.21.10.19; Kś.23.3.1; Apś.22.19.1; Mś.9.4.2.9.
daivas tantur asy anu tvā rabhe māhaṃ tvad vyavachitsi # śś.2.12.9. Cf. tantur asi.
daivīṃ vācaṃ vadasi # TA.4.34.1b; HG.1.16.19b.
daivīṃ vācam udyāsaṃ (śivām ajasrāṃ juṣṭāṃ devebhyas svadhāvatīṃ pitṛbhyaś śuśrūṣeṇyāṃ manuṣyebhyaḥ) # KA.1.208E; 3.208E. See under next.
daivīṃ vācam udyāsaṃ juṣṭāṃ devebhyaḥ svadhāvarīṃ pitṛbhyo 'numatāṃ (text -tān) manuṣyebhyaḥ # MS.4.9.2: 122.10. See prec., and vaiśvadevīṃ vācam.
drapsaṃ davidhvad gaviṣo na satvā # RV.4.13.2b.
druho nido mitramaho avadyāt # RV.4.4.15d; TS.1.2.14.6d; MS.4.11.5d: 174.8; KS.6.11d.
dvādaśa vā etā rātrīḥ # AVś.4.11.11a. See dvādaśaitā.
dvādaśena trayodaśopamāsaḥ # JB.1.18b. See trayodaśena dvādaśopamāsaḥ.
dvādaśaitā rātrīḥ # AVP.3.25.7a. See dvādaśa vā.
dvādaśyā rātryā dvādaśyā samidhā # AVP.9.20.12.
dvā rathā vadhumantā sudāsaḥ # RV.7.18.22b.
dvitā ca sattā svadhayā ca śaṃbhuḥ # RV.3.17.5b; N.5.3.
dvitā bhuvad rayipatī rayīṇām # RV.9.97.24c.
dviṣato naḥ parā vada # TA.4.34.1c; HG.1.16.19c.
dviṣato badho (Mś. vadho) 'si # VS.1.28; Mś.1.2.4.26. P: dviṣato badhaḥ Kś.2.6.42.
dvau yad-yad vadataḥ sanniṣadya # AVP.5.32.4c. Cf. next but one.
dhartā divaḥ pavate kṛtvyo (JB. kṛtviyo) rasaḥ # RV.9.76.1a; SV.1.558a; 2.578a; JB.3.219; PB.14.9.4. Designated as padastobhāḥ ViDh.56.11; VāDh.28.12. Cf. dhanaṃjayaḥ pa-.
dharmaṇe kaṃ svadhayā paprathanta # RV.10.88.1d; N.7.25d.
dharmaṃ dharmavido janāḥ # VāDh.1.16b.
dharmā bhuvad vṛjanyasya rājā # RV.9.97.23c.
dhātar āyantu sarvadā (TAṭU. sarvataḥ svāhā) # TA.7.4.3d; TU.1.4.3d; Kauś.56.17d. See samavayantu sarvataḥ.
dhiṣaṇās tvā devīr viśvadevyāvatīḥ (MSṃś. dhiṣaṇā tvā devī viśvadevyavatī) pṛthivyāḥ sadhasthe aṅgirasvad (TS. 'ṅgi-) abhīndhatām (MS.2.7.6, abhīnddhām; MS.3.1.8, abhīndhātām) ukhe # VS.11.61; TS.4.1.6.2; MS.2.7.6: 81.11; 3.1.8: 10.4; KS.16.6; śB.6.5.4.5. Ps: dhiṣaṇās tvā devīḥ Apś.16.5.9; dhiṣaṇā tvā devī Mś.6.1.2.17; dhiṣaṇās tvā TS.5.1.7.2; KS.19.7; Kś.16.4.12.
dhībhiḥ kṛtaḥ pra vadāti (AVP. bharasva) vācam # AVś.5.20.8a; AVP.9.27.6a.
dhībhir arvadbhir arvataḥ # RV.6.45.12a.
dhīrataro varuṇa svadhāvan # AVś.5.11.4b. See na dhīrataro.
dhūmas te ketur abhavad divi śritaḥ # RV.5.11.3d; TB.2.4.3.3d.
dhṛtām achāvadāmasi # AVś.12.1.27d.
dhṛtī stho vidhṛtī svadhṛtī # TB.3.7.6.8d; Apś.4.6.5d.
dhenuṃ ca viśvadohasam # RV.6.48.13b.
dhenur abhavad yame # AVś.3.10.1b; AVP.1.104.1b; KS.39.10b; SMB.2.8.1b. See sā dhenur etc.
dhenūr iva manave viśvadohasaḥ # RV.1.130.5f.
dhruvāyāṃ tvā diśi purā saṃvṛtaḥ svadhāyām ā dadhāmi # AVś.18.3.34.
dhvasrā apinvad yuvatīr ṛtajñāḥ # RV.4.19.7b.
dhvāntāt prapitvād ud aranta garbhāḥ # RV.10.73.2d; śś.14.49.3.
na ṛte tvad amṛtā mādayante # RV.7.11.1b.
na kāvyaiḥ paro asti svadhāvaḥ # RV.5.3.5b.
na ki indra tvad uttaram # SV.1.203a. Cf. Svidh.1.4.21. See nakir indra.
nakir indra tvad uttaraḥ # RV.4.30.1a; Aś.6.4.10; śś.18.13.2. Cf. BṛhD.4.133. See na ki indra.
nakiṣ ṭvad rathītaraḥ # RV.1.84.6a; SV.2.300a.
na ghā tvadrig apa veti me manaḥ # RV.10.43.2a; AVś.20.17.2a.
na tam aṃho na duritam # RV.10.126.1a; AVP.5.39.1a; SV.1.426a; VHDh.8.47. Ps: na tam aṃhaḥ VāDh.26.7; MDh.11.252; LAtDh.2.6; na tam Rvidh.4.4.4. Cf. BṛhD.8.44.
na tvad anyaḥ kavitaro na medhayā (AVP. na vedhāḥ) # AVś.5.11.4a; AVP.8.1.4a.
na tvad anyo maghavann asti (PB. asti ca) marḍitā # RV.1.84.19c; SV.1.247c; 2.1073c; VS.6.37c; PB.8.1.5c; śB.3.9.4.24c; N.14.28c. See no tvad.
na tvad dhotā pūrvo agne yajīyān # RV.5.3.5a.
na tvāvāṃ anyo amṛta tvad asti # RV.6.21.10d.
nadyāḥ kūlān nāvam ivādhi śambī # AVP.1.46.5b. Cf. śambīva nāvam.
nadyo ajinvad adruhaḥ # RV.9.9.4b.
na dhīrataro varuṇa svadhāvaḥ # AVP.8.1.4b. See dhīrataro.
na nāmayati na rudati na hṛṣyati na glāyati yatra vayaṃ vadāmo yatra cābhimṛśāmasi # PG.1.16.25.
na brahma tasmai prabrūyāt # VāDh.2.12c. See tasmai brahma na.
na ma āśṛṇoḥ kim abhug vadāsi # RV.10.95.11d.
namaḥ kaḥsvadheye # AVP.7.11.9c.
namas tiṣṭhadbhyo dhāvadbhyaś ca vo namaḥ # VS.16.23; TS.4.5.3.2; MS.2.9.4: 123.13; KS.17.13.
namas te rudra manyave # VS.16.1a; TS.4.5.1.1a; MS.2.9.2a: 120.16; 4.12.1: 178.15; KS.17.11a; śB.9.1.1.14; Apś.17.11.4; Mś.5.1.9.28; 6.2.4.3; 11.7.1.17,21; HG.2.8.11; MG.2.5.3. P: namas te Kś.18.1.1. Designated as rudra, rudra-sūktam, and rudrāḥ ApG.7.20.8; GDh.19.12; VāDh.22.9; ViDh.86.12; BDh.3.10.10; 4.3.8; 6.1.4; YDh.3.304; SaṃvartaDh.225; as śatarudriya and śatarudrīya MS.3.3.4: 36.12; KS.21.6; Apś.17.11.3; 12.2; ViDh.56.21; VāDh.28.14; LAtDh.3.12; VAtDh.3.12; BṛhPDh.9.148; AuśDh.3.85. See also Pet. Lex. under these words.
namasyata havyadātiṃ svadhvaram # RV.3.2.8a.
namaḥ sravadbhyaḥ # Rvidh.2.1.5.
na māṃ brūyā vīryavatī tathā syām # ViDh.29.9d; VāDh.2.8d. See na mā brūyā.
namo agrevadhāya (MS.KS. 'grevadhāya) ca dūrevadhāya ca # VS.16.40; TS.4.5.8.1; MS.2.9.7: 126.3; KS.17.15.
namo gandharvāya viṣvagvādine # PB.1.3.10. P: namo gandharvāya Lś.1.12.16.
namo 'grevadhāya etc. # see namo agre-.
namo devavadhebhyaḥ # AVś.6.13.1a; Kauś.14.25; 15.6; 72.13; 104.3; 105.1; 113.3; 123.1.
namo rājavadhebhyaḥ # AVś.6.13.1b.
namo vaḥ pitaraḥ svadhāyai # VS.2.32; TS.3.2.5.5; TB.1.3.10.8; śś.4.5.1; SMB.2.3.10; GG.4.3.20; KhG.3.5.27. See svadhāyai ca, and svadhāyai vaḥ.
na vā u devāḥ kṣudham id vadhaṃ daduḥ # RV.10.117.1a. P: na vā u devāḥ Rvidh.4.4.1. Cf. BṛhD.8.40.
na vā ojīyo rudra tvad asti # RV.2.33.10d; TA.4.5.7d; KA.2.92d. See ojīyo rudras.
naśyantu mama sarvadā # RVKh.5.87.29d.
na saṃvādāya ramate # RV.8.101.4b.
na svadhitir vananvati # RV.8.102.19b.
nahi tvad anyaḥ puruhūta kaś cana # RV.8.66.13c.
nahi tvad anyan maghavan na āpyam # RV.7.32.19c; AVś.20.82.2c; SV.2.1147c.
nahi tvad anyo girvaṇo giraḥ saghat # RV.1.57.4c; AVś.20.15.4c; SV.1.373c.
nahi tvad āre nimiṣaś caneśe # RV.2.28.6d; MS.4.14.9d: 229.2; N.13.1.
nahi tvad indra vasyo anyad asti # RV.5.31.2c.
nātārīd (TB. nātārīr) asya samṛtiṃ vadhānām (TB. badhānām) # RV.1.32.6c; AVP.12.12.6c; TB.2.5.4.4c.
nāma svadhāvan guhyaṃ (ApMB. svadhāvat svaryaṃ) bibharṣi # RV.5.3.2b; ApMB.1.5.12b. See devaḥ svadhāvo etc.
nāmāni kṛtvābhivadan yad āste # TA.3.12.7d.
nāyam achā maghavā śṛṇavad giraḥ # RV.8.33.13c.
nāsām avadyam avidaṃ na ripram # AVP.6.3.10c.
ni tvādhamasmi lomni # AVP.1.64.4c.
nidhiṃ rakṣanti sarvadā # AVś.10.7.23b.
nidhiṃ śevadhiṃ pari dadma etam # AVś.12.3.46b.
nir aṃhasaḥ pipṛtā (TB. pipṛtān) nir avadyāt # RV.1.115.6b; VS.33.42b; MS.4.14.4b: 220.11; TB.2.8.7.2b.
nirṛtir durhaṇā vadhīt # RV.1.38.6b.
nir yat pūteva svadhitiḥ śucir gāt # RV.7.3.9a.
ni vīraṃ (TS. vīravad) gavyam aśvyaṃ (TS. aśviyaṃ) ca rādhaḥ # RV.7.92.3d; VS.27.27d; TS.2.2.12.8d; MS.4.10.6d: 158.5; KS.10.12d; KA.1.198.32d.
nīcād uccā svadhayābhi (AVP. svadhā abhi) pra tasthau # AVP.5.2.3d; TS.2.3.14.6d; KS.10.13d. See nīcair uccaiḥ.
nīcāvayā abhavad vṛtraputrā # RV.1.32.9a; AVP.12.12.9a.
nīcair uccaiḥ svadhā abhi pra tasthau # AVś.4.1.3d. See nīcād uccā sva-.
nū no gomad vīravad dhehi ratnam # RV.7.75.8a.
nṛbhir jigāya sutasomavadbhiḥ # RV.10.69.11b.
nṛvadbhyo 'kṣā paprathānebhir evaiḥ # TB.2.8.4.7d. See ruvad.
nṛvan navīyaḥ śṛṇavad yathā naḥ # RV.7.26.1d.
ned eṣa yuṣmad (TSṭB. tvad) apacetayātai # TS.1.1.13.2d; MS.4.1.14d: 20.6; TB.3.3.9.6; Mś.1.3.4.26d. See eṣa net.
nem āpo aśvadātaraḥ # RV.8.74.15c.
nairṛtyai svāhā # VāDh.23.3. Cf. nirṛtyai svāhā.
nopaspijaṃ vaḥ pitaro vadāmi # RV.10.88.18c.
ny amitreṣu vadham indra tumram # RV.10.89.9c.
ny asmabhyaṃ svadhite yacha yā amūḥ # AVś.9.4.6d.
ny asmai devī svadhitir jihīte # RV.5.32.10a.
pañcapādaṃ pitaraṃ dvādaśākṛtim # RV.1.164.12a; AVś.9.9.12a; PraśU.1.11a.
patir gavām abhavad eka indraḥ # RV.3.31.4d.
patir yad vadhvo (ApMB. vadhvai) vāsasā # RV.10.85.30c; AVś.14.1.27c; ApMB.1.17.8c.
padbhyāṃ śūdro ajāyata # RV.10.90.12d; AVś.19.6.6d; AVP.9.5.6d; VS.31.11d; TA.3.12.6d; VāDh.4.2d.
payo ghṛtavad vidatheṣv ābhuvaḥ # RV.1.64.6b; TS.3.1.11.7b.
parāṅ eva parā vada # AVś.6.29.3c.
pari krośatu sarvadā (ApMB. sarvataḥ) # HG.1.14.4d; ApMB.2.22.9d.
parikṣavāc chakuneḥ pāpavādāt # AVś.10.3.6c.
parijmeva svadhā gayaḥ # RV.6.2.8c.
pari daivīr anu svadhāḥ # RV.9.103.5a.
pari vaḥ sainyād vadhāt # śG.3.9.1a.
parivādaṃ parikṣavam # AVś.19.8.4b; Nakṣ.26.4b. See parīvādaṃ.
parīḍābhir ghṛtavadbhiś ca havyaiḥ # RV.7.3.7b.
parīvādaṃ parikṣapam # ApMB.1.13.5b. See parivādaṃ.
parjanyaś citrāṃ vadati tviṣīmatīm # RV.5.63.6b; MS.4.14.12b: 234.7; TB.2.4.5.4b.
paryādadhati sarvadā # AVś.12.2.51d.
pavane pāvane caiva # VāDh.1.16c.
pavamāna svādhyaḥ # RV.9.65.4c. See prec. but one.
pavamānaḥ svadhvaraḥ # RV.9.3.8c; SV.2.613c.
pavasva viśvadarśataḥ # RV.9.65.13b; 106.5b.
paśau saṃvadasva # Kś.10.5.6.
paścāt sindhur vidhāraṇī # VāDh.1.15a. Cf. sindhuḥ paścāt.
paścedam anyad abhavad yajatram # RV.10.149.3a; śB.10.2.2.3.
paṣṭhavāḍ gaur vayo dadhuḥ # VS.21.17d; KS.38.10d; TB.2.6.18.3d. See pṛṣṭhavāḍ, and cf. next but one.
paṣṭhavāḍ (TS. -vād) vayaḥ # VS.14.9; TS.4.3.3.2; 5.1; MS.2.7.20: 105.19; 2.8.2: 108.2; KS.17.2; 39.7; śB.8.2.4.6; Apś.17.1.8.
pātām avadyād duritād abhīke # RV.1.185.10c.
pātu no duritād avadyāt # AVP.2.70.4d. Cf. agnir naḥ pātu duritād.
pātreṣu dattam amṛtaṃ svadhāvat # JG.2.1b.
pāthaḥ sumekaṃ svadhitir vananvati # RV.10.92.15d.
pānti mitrāvaruṇāv avadyāt # RV.1.167.8a.
pāpaṃ jīvanti sarvadā # AVś.12.2.50d.
pāpān nirghnanti sarvadā # TA.1.8.6b.
pāpāḥ saṃyanti sarvadā # TA.1.8.5b.
pārāvataghnīm (TB. pārāvadaghnīm) avase suvṛktibhiḥ # RV.6.61.2c; MS.4.14.7c: 226.10; KS.4.16c; TB.2.8.2.8c; N.2.24c.
pāvamānāḥ pāvamānyaḥ, and pāvamānyāḥ # GDh.19.12; 20.12; ViDh.56.8; VāDh.22.9; 28.11; BDh.2.4.7.2; 10.17.37; 4.3.8; 7.5; MDh.5.86; 11.258; LHDh.4.30; VHDh.2.118; 5.334,437,502; 6.71,378,400,412; 7.252,283; SaṃvartaDh.224; BṛhPDh.5.250; LAtDh.2.4; 3.11; VAtDh.2.4; 3.11; Rvidh.1.3.5; 2.35.7; 3.4.1; 4.25.1. Designations of RV.9.1.1 ff. See svādiṣṭhayā.
pitara āyuṣmantas te svadhayāyuṣmantaḥ (PG. svadhābhir āyuṣ-) # TS.2.3.10.3; PG.1.16.6.
pitāmahān svadhā namas tarpayāmi # BDh.2.5.10.1.
pitāmahīḥ svadhā namas tarpayāmi # BDh.2.5.10.1.
pitāmahebhyaḥ svadhāyibhyaḥ (TB.Apś. -vibhyaḥ) svadhā namaḥ # VS.19.36; KS.38.2; śB.12.8.1.7; TB.2.6.3.2; Apś.1.9.9. Cf. svadhā pitā.
pituḥ pratnasya janmanā vadāmasi # RV.1.87.5a.
pitṛbhyaḥ somavadbhyaḥ svadhā namaḥ # AVś.18.4.73. See svadhā pitṛbhyaḥ soma-.
pitṛbhyaḥ somavadbhyo 'nubrūhi # śB.2.6.1.26.
pitṛbhyaḥ somavadbhyo babhrūn dhūmrānūkāśān # Apś.20.14.13. See babhravo dhūmra-.
pitṛbhyaḥ svadhā # Mś.1.6.1.45; MG.2.12.20. See svadhā pi-.
pitṛbhyaḥ svadhā astu # see pitṛbhyaḥ svadhāstu.
pitṛbhyaḥ svadhāṃ karomi # Vait.7.15.
pitṛbhyaḥ svadhā namaḥ # PG.2.9.9; VārG.17.15; VyāsaDh.3.32.
pitṛbhyaḥ svadhāyibhyaḥ (TB.Apś. -vibhyaḥ) svadhā namaḥ # VS.19.36; KS.38.2; śB.12.8.1.7; TB.2.6.3.2; Apś.1.9.9; 19.8.14. P: pitṛbhyaḥ Kś.19.3.17.
pitṛbhyaḥ svadhāstu (MahānU. -dhā astu) # Tā.10.67.2; MahānU.19.2.
pitṝn svadhā namas tarpayāmi # BDh.2.5.10.1.
pippalyaḥ samavadanta # AVś.6.109.2a. Cf. avapatantīr.
piba svadhainavānām # RV.8.32.20a.
pibā somam anuṣvadhaṃ madāya # RV.3.47.1b; VS.7.38b; VSK.28.10b; TS.1.4.19.1b; MS.1.3.22b: 38.1; KS.4.8b; N.4.8b.
piśaṅgā vaiśvadevāḥ # MS.3.13.12: 171.1. See bahurūpā vai-.
pīvasvatīr jīvadhanyāḥ pibantu (KSA. -ti) # RV.10.169.1c; TS.7.4.17.1c; KSA.4.6c.
puṇḍarīkaṃ navadvāram # AVś.10.8.43a.
puṇyam ayaṃ brāhmaṇa upahavakāmo vadatīmaṃ hotar upahvayasva # Mś.2.4.1.50. See taṃ hotar.
putraṃ narā vadhrimatyā adattam # RV.1.117.24b.
punaḥ kaler akṛṇutaṃ yuvad vayaḥ # RV.10.39.8b.
punantv asmān duritād avadyān # AVP.6.3.3c.
punarmagheṣv avadyāni bhūri # AVś.5.11.7b; AVP.8.1.7b.
punas tvādityā rudrā vasavaḥ # AVś.12.2.6a. P: punas tvā Vait.28.22. See next.
punas tvādityā rudrā vasavaḥ samindhatām # VS.12.44a; TS.4.2.3.4a; 5.2.2.5; MS.1.7.1a: 108.9; KS.8.14a; 38.12a; śB.6.6.4.12; Apś.9.10.9; 16.12.13; Mś.1.6.5.8. P: punas tvā Kś.16.7.2. See prec.
purā devā anavadyāsa (MS. -sā) āsan # RV.7.91.1b; MS.4.14.2b: 216.11.
purā nu jaraso vadhīt # RV.8.67.20c.
purā sāyatvād atyākṣam # AVP.3.40.5e.
purukṣuṃ viśvadhāyasam # RV.8.5.15c; 7.13b.
purutrā vācaṃ pipiśur vadantaḥ # RV.7.103.6d.
purudasmo viṣurūpa (KS. purudasmavad viśvarūpam) induḥ # VS.8.30a; KS.13.9a; śB.4.5.2.12a. Ps: purudasmaḥ Kś.25.10.13; purudasmavat KS.13.10. See urudrapso.
purudṛṣṭo adṛṣṭahā # AVP.5.3.1b. See viśvadṛṣṭo adṛṣṭahā.
puruścandraṃ yajataṃ viśvadhāyasam # RV.5.8.1c.
puruṣasūkta pauruṣasūkta, and the like # GDh.19.12; ViDh.56.15,26; 64.23,38; 65.15; 86.12; VāDh.22.9; 26.7; 28.13; BDh.3.10.10; MDh.11.252; LHDh.4.55; VHDh.2.13; 4.30,85,127; 5.136,195,211,216,378,404,406,555,566; 7.69,103,258; 8.31; LAtDh.2.6; VAtDh.2.6; SaṃvartaDh.224; BṛhPDh.9.319; Rvidh.3.26.3; 29.5; 35.1. Designation of the hymn beginning sahasraśīrṣā, q.v.
puṣṭyai me varcodāḥ pavadhvam # Apś.12.18.20.
pūrvam agniṃ vadhūr iyam # AVś.14.2.20b.
pūrve ardhe viṣite sasan nu # AVś.4.1.6d. See pūrvād ardhād.
pūrvo dundubhe pra vadāsi vācam # AVś.5.20.6a.
pūṣṇo bhāgo nīyate viśvadevyaḥ # RV.1.162.3b; VS.25.26b; TS.4.6.8.1b; MS.3.16.1b: 181.11; KSA.6.4b.
pṛthivīṃ viśvadhāyasam # AVś.12.1.27c; AVP.1.3.1d.
pṛthivyāḥ sadhasthād agniṃ purīṣyam aṅgirasvad achehi # TS.4.1.2.2; 5.1.2.4. Cf. agniṃ purīṣyam etc.
pṛthivyāḥ sadhasthād agniṃ purīṣyam aṅgirasvad ā bhara # VS.11.16; TS.4.1.1.4; KS.16.1; 19.2; śB.6.3.1.38; 2.9. P: pṛthivyāḥ sadhasthāt Kś.16.2.10. Cf. agniṃ purīṣyam etc.
pṛṣatī kṣudrapṛṣatī sthūlapṛṣatī tā maitrāvaruṇyaḥ (KSA. vaiśvadevyaḥ) # VS.24.2; MS.3.13.3: 169.4; KSA.9.2. See next but one.
pṛṣatī sthūlapṛṣatī kṣudrapṛṣatī tā vaiśvadevyaḥ # TS.5.6.12.1. See prec. but one.
pṛṣato vaiśvadevaḥ # TS.5.5.17.1; KSA.7.7.
pṛṣṭhavāḍ (Padap. paṣṭa-) gaur vayo dadhuḥ # MS.3.11.11d: 158.9. See paṣṭhavāḍ etc.
prakṛtebhyaḥ svadhocyatām # YDh.1.243. Cf. under astu svadheti.
pra cakramur hitvāvadyam āpaḥ # AVP.6.3.11b; MS.1.2.1b: 9.12; Apś.10.6.1b; ApMB.1.2.1b.
prajātim upāvadhīḥ # Apś.10.2.11.
prajānāṃ tvādhipatyāya # VS.18.28; KS.18.12; śB.9.3.3.10,11.
prajāpate na tvad etāny anyaḥ (MS.4.14.1a, na hi tvat tāny anyaḥ; KS. nahi tvad anya etā) # RV.10.121.10a; AVś.7.80.3a; VS.10.20a; 23.65a; VSK.29.36a; TS.1.8.14.2a; 3.2.5.6a; MS.2.6.12a: 72.4; 4.14.1a: 215.9; KS.15.8a; ṣB.1.6.19a; śB.5.4.2.9a; 13.5.2.23; 14.9.3.3; TB.1.7.8.7; 2.8.1.2a; 3.5.7.1a; Tā.10.54a; BṛhU.6.3.3; Aś.2.14.12; 3.10.23; Vait.1.3; 2.12; 7.12; AG.1.4.4; 14.3; 2.4.14; Kauś.5.9; SMB.2.5.8a; ApMB.2.22.19a (ApG.8.23.9); JG.1.4a; N.10.43a. Ps: prajāpate na tvad etāni Apś.1.10.8; 9.2.4; 13.6.11; 12.12; 18.16.14; prajāpate na tvat śś.16.7.3; Apś.9.20.1 (comm.); Mś.1.1.2.38; 9.1.4.27; prajāpate TS.2.2.12.1; 6.11.4; TB.3.7.11.3; śś.4.10.4; 18.4; 10.13.23; 21.1; 15.13.11; Kś.15.6.11; Apś.3.11.2; 9.12.4; 14.32.6; śG.1.18.4; 22.7; Kauś.59.19; GG.4.6.9; HG.1.3.6; 8.16; 9.7; 17.6; 18.6; 19.8; 26.14; 27.1; 28.1; 2.1.3; 2.2; 4.10; 5.2; 6.2; 15.13; JG.1.20; BṛhPDh.9.323. Designated as prājāpatyā (sc. ṛk) KhG.4.1.20. Cf. amāvāsye na.
prajāpate viśvasṛj (MS. -sṛg) jīvadhanyaḥ # MS.4.14.1c: 215.16; TB.2.8.1.4c; Aś.2.14.12c; Apś.20.20.9c.
prajābhir agne amṛtatvam aśyām # RV.5.4.10d; TS.1.4.46.1d; ApMB.2.11.5d; BDh.2.6.11.33; VāDh.17.4.
prajāṃ mā nir vādiṣṭam # VS.5.17; śB.3.5.3.18.
pra ṇo muñcataṃ duritād avadyāt # AVP.1.109.2c. Cf. under mumuktam asmān.
pra tan me voco dūḍabha svadhāvaḥ # RV.7.86.4c.
pratanvatīr oṣadhīr ā vadāmi # AVś.8.7.4b.
pratitiṣṭhantaṃ tvādityānupratitiṣṭhāsam # SMB.2.5.16; GG.4.6.12. P: pratitiṣṭhantaṃ tvā KhG.4.1.27.
prati tvāditir vettu # VS.1.14,19; śB.1.1.4.5; 2.1.14. P: prati tvā Kś.2.4.5. See prati tvā pṛthivī.
prati tvādityās tvag vettu (TB. Poona ed. vetu) # VS.1.14,19; TS.1.1.5.2; 6.1; MS.1.1.6: 3.12 (bis); 1.1.7: 4.3 (bis); KS.1.5; 1.6; 31.5; śB.1.1.4.7; 2.1.15; TB.3.2.5.7; 6.2.
prati tvādya sumanaso budhanta # RV.7.78.5a.
prati tvā pṛthivī vettu # TS.1.1.5.1; 6.1 (bis); KS.1.5; 1.6; TB.3.2.5.6; 6.1. See prati tvāditir.
prati tvā śavasī vadat # RV.8.45.5a.
pratiprasthātaḥ paśuṃ saṃvadasva # see pratiprasthātaḥ paśau.
pratiprasthātaḥ paśau (Mś. paśuṃ) saṃvadasva # Apś.13.11.1; Mś.2.5.1.23.
pratiprasthātar ya upāṃśupātre 'ṃśus tam ṛjīṣe 'pyasyābhiṣutyodañcaṃ hṛtvādhavanīye praskandayasva # Mś.2.5.1.11.
prati stomebhir uṣasaṃ vasiṣṭhāḥ # RV.7.80.1a. P: prati VāDh.26.5; MDh.11.250.
pratīcīnaḥ sahure viśvadhāyaḥ (AVś.AVP. viśvadāvan) # RV.10.83.6b; AVś.4.32.6b; AVP.4.32.6b.
pratīcyāṃ tvā diśi purā saṃvṛtaḥ svadhāyām ādadhāmi # AVś.18.3.32.
pratnavadbhiḥ prattaḥ svadhayā # AG.4.7.11c.
praty āyaṃ sindhum āvadan # RV.1.11.6b; JB.3.238b.
pratrāsam amitrebhyo vada # AVś.5.21.3c.
pra diva ṛṣvād bṛhataḥ sudānū # RV.7.61.3b.
pra naḥ pūṣā carathaṃ viśvadevyaḥ # RV.10.92.13a.
pra nu vocaṃ vādhryaśvasya nāma # RV.10.69.5d.
pra parvatānām uśatī upasthāt # RV.3.33.1a; N.9.39a. Cf. BṛhD.4.105. Designated as viśvāmitrasya saṃvādaḥ Rvidh.2.1.4.
prapitāmahān (and -mahīḥ) svadhā namas tarpayāmi # BDh.2.5.10.1.
prapitāmahebhyaḥ svadhāyibhyaḥ (TB.Apś. -vibhyaḥ) svadhā namaḥ # VS.19.36; KS.38.2; śB.12.8.1.7; TB.2.6.3.2; Apś.1.9.9.
pra pinvadhvam iṣayantīḥ surādhāḥ # RV.3.33.12c.
prapīnam akṣitaṃ viśvadānīm # AVP.5.40.5a.
prapunvanta upa spṛśata prapunvadbhya svāhā # ApMB.2.18.38 (ApG.7.20.5). See prayunvanta.
prapharvyaṃ ca pīvarīm # VS.12.71d; TS.4.2.5.6d; MS.2.7.12e: 91.18; KS.16.12e; śB.7.2.2.11; VāDh.2.34d,35. See pībarīṃ ca.
prabhartum āvad andhasaḥ sutasya # RV.3.48.1b.
prabhrājamānā vyavadātāḥ # TA.1.9.1a.
pra maṇḍūkā avādiṣuḥ # RV.7.103.1d; AVś.4.15.13d; AVP.5.7.12d; N.9.6d.
pra medhiraḥ svadhayā pinvate padam # RV.9.68.4b.
prayunvanta upaspṛśata prayunvadbhyaḥ svāhā # HG.2.9.2. See prapunvanta.
pra ye vasubhya īvad ā namo duḥ # RV.5.49.5a.
pra vartanīr arado viśvadhenāḥ # RV.4.19.2d.
pravācyaṃ śaśvadhā vīryaṃ tat # RV.3.33.7a.
pra śmaśru (SV. śmaśrubhir) dodhuvad ūrdhvathā bhūt (SV. ūrdhvadhā bhuvat) # RV.10.23.1c; SV.1.334c.
pra saptavadhrir āśasā # RV.8.73.9a.
pra sumedhā gātuvid viśvadevaḥ # RV.9.92.3a.
pra somāsaḥ svādhyaḥ # RV.9.31.1a.
prasthāvad rathavāhanam # AVś.3.17.3d; VS.12.71e; TS.4.2.5.6e; MS.2.7.12d: 91.18; KS.16.12d; śB.7.2.2.11; VāDh.2.34e.
pra svadhitīva rīyate # RV.5.7.8b.
prasvaṃ tvāvadhrim avaśāṃ kṛṇomi # AVP.11.1.4b.
pra svādanaṃ pitūnām # RV.5.7.6c.
pra svādmāno (KS. svādyamāno) rasānām # RV.1.187.5c; AVP.6.16.5c; KS.40.8c.
prācyāṃ tvā diśi purā saṃvṛtaḥ svadhāyām ā dadhāmi # AVś.18.3.30. P: prācyāṃ tvā diśi Kauś.80.53.
prāṇam upāvadhīḥ # Apś.10.2.11.
prāṇena samavādiran # AVś.11.4.6b.
prāṇo ha satyavādinam # AVś.11.4.11c.
prātaḥ-prātar anṛtaṃ te vadanti # AB.5.31.6a.
prātaḥ prātaḥsāvasyendrāya puroḍāśānām anubrūhi (Apś. also, avadīyamānānām anubrūhi, and preṣya) # Apś.12.20.15; Mś.2.3.7.9.
prādāḥ (SMB. -dāt) pitṛbhyaḥ svadhayā te akṣan # RV.10.15.12c; AVś.18.3.42c; VS.19.66c; TS.2.6.12.5c; Apś.1.10.14c; SMB.2.3.17c.
priyaṃ cetiṣṭham aratiṃ svadhvaram (RV.1.128.8b, ny erire) # RV.1.128.8b; 7.16.1c; SV.1.45c; 2.99c; VS.15.32c; TS.4.4.4.4c; MS.2.13.8c: 157.4; KS.39.15c.
priyāṇy aṅgāni svadhitā parūṃṣi (AVP.Vait. aṅgā sukṛtā purūṇi) # AVP.2.39.2b; TB.3.7.13.1b; Vait.24.1b.
priyā dhāma yuvadhitā minanti # RV.6.67.9b.
priyāya priyavādinam # VS.30.13; TB.3.4.1.7.
prīyatāṃ dharmarājā # VāDh.28.19.
premāṃ vācaṃ vadiṣyāmi bahu kariṣyantīṃ bahu kariṣyan bahor bhūyaḥ svargam iṣyantīṃ svargam iṣyan (Lś. kariṣyan svargam ayiṣyantīṃ svargam ayiṣyan mām imān yajamānān) # śś.17.17.1; Lś.4.2.10. See next.
premāṃ vācaṃ vadiṣyāmi bahu vadiṣyantīṃ bahu patiṣyantīṃ bahu kariṣyantīṃ bahu saniṣyantīṃ bahor bhūyaḥ kariṣyantīṃ svar gachantīṃ svar vadiṣyantīṃ svaḥ patiṣyantīṃ svaḥ kariṣyantīṃ svaḥ saniṣyantīṃ svar imaṃ yajñaṃ vakṣyantīṃ svar māṃ yajamānaṃ vakṣyantīm # ā.5.1.5.4. See prec.
praiṣyaṃ janam iva śevadhim # AVś.5.22.14c. Cf. jane priyam.
proṣṭhapadāsa iti yān vadanti # TB.3.1.2.9b.
bandhād baddham ivādite # RV.8.67.18c.
babhravo dhūmranīkāśāḥ pitṝṇāṃ barhiṣadām # VS.24.18. See pitṛbhyaḥ somavadbhyo babhrūn.
barhir yajñe svadhvare # RV.1.142.5b.
barhiṣadaḥ svadhayā ye sutasya # MS.4.10.6c: 157.1. See barhiṣado ye.
barhiṣado ye svadhayā sutasya # RV.10.15.3c; AVś.18.1.45c; VS.19.56c; TS.2.6.12.3c; KS.21.14c; AB.3.37.16. See barhiṣadaḥ svadhayā.
bahurūpā vaiśvadevāḥ # VS.24.14; Apś.20.14.7; 15.3. See piśaṅgā vai-.
bahor agna ulapasya svadhāvaḥ # RV.10.142.3b.
bālaghnān mātṛpitṛvadhād bhūmitaskarāt # RVKh.9.67.12a.
bāhubhyām ūrubhyām aṣṭhīvadbhyām # TB.3.7.12.2b; TA.2.3.1b.
bāhū rājanyaḥ kṛtaḥ (AVś.AVP. rājanyo 'bhavat) # RV.10.90.12b; AVś.19.6.6b; AVP.9.5.6b; VS.31.11b; TA.3.12.5b; VāDh.4.2b.
bṛhatīm indrāya vācaṃ vada # VS.5.22; TS.1.3.2.2; MS.1.2.10: 19.17; 3.8.8: 106.9; KS.2.11; 25.9; śB.3.5.4.8.
bṛhat svaścandram amavad yad ukthyam # RV.1.52.9a.
bṛhad vayo maghavadbhyo dadhāta # RV.7.58.3a.
bṛhantaṃ mānaṃ varuṇa svadhāvaḥ # RV.7.88.5c; MS.4.14.9c: 229.8.
bṛhann adrir abhavat tad eṣām (AVś. abhavad yac charīram; MS.KS. abhavad yat tad āsīt) # AVś.9.4.5d; TS.3.3.9.2d; MS.2.5.10d: 61.13; KS.13.9d.
bṛhaspataye tvā viśvadevyāvate svāhā # VS.38.8; śB.14.2.2.10; TA.4.9.2; 5.7.11.
bṛhaspataye vācaṃ vadata # VS.9.11; śB.5.1.5.8.
bṛhaspatiṃ te viśvadevavantam ṛchantu, ye māghāyava ūrdhvāyā diśo 'bhidāsān # AVś.19.18.10; AVP.7.17.10.
bṛhaspatir mithoavadyapebhiḥ # RV.10.67.8c; AVś.20.91.8c.
bṛhaspate mā praṇak tasya no vadhaḥ # RV.2.23.12c; KS.4.16c.
bodha pratībodhāsvapnānavadrāṇa gopāyamāna rakṣamāṇa jāgṛve 'rundhati ye devās tanūpāḥ stha te ma iha tanvaṃ pāta # KS.37.10. Cf. next but two and next but three.
brahmaṇas pater abhavad yathāvaśam # RV.2.24.14a; MS.4.14.10a: 230.12; TB.2.8.5.2a.
brahman mā tvaṃ vado bahu # VS.23.25d.
brahma pṛṣṭam anādṛtam # SaṃhitopaniṣadB.3b; VāDh.2.11b.
brahma prajāvad ā bhara # RV.6.16.36a; SV.2.748a; śś.9.22.4.
brahma prajāvad rayim aśvapastyam # RV.9.86.41c.
brahma prāvādiṣma tan no mā hāsīt # TA.4.42.5.
brahma brāhmaṇo vadati # AVP.8.9.3a.
brahma metu mām # TA.10.48.1; MahānU.17.6. Cf. trisuparṇa GDh.15.28; ApDh.2.7.17.22; ViDh.56.23; VāDh.28.14; YDh.1.219; VAtDh.3.12; LAtDh.3.12.
brahmā tvo vadati jātavidyām # RV.10.71.11c; N.1.8c.
brāhmaṇānāṃ parīvādam # ViDh.48.22e; BDh.3.6.5c.
brāhmaṇo 'sya mukham āsīt # RV.10.90.12a; AVś.19.6.6a; AVP.9.5.6a; VS.31.11a; TA.3.12.5a; VāDh.4.2a.
bhagaṃ vṛṇānā vadhvaṃ vahanti # AVP.10.6.9a.
bhagena vācam iṣitāṃ vadāni # AVP.10.6.4a.
bhadraṃ naḥ sarvato vada # RVKh.2.43.3d.
bhadraṃ no abhayaṃ vada # RVKh.2.43.2d; Kauś.46.54d.
bhadram adhastān no vada # RVKh.2.43.3a.
bhadram asmākaṃ vada # RVKh.2.43.2c; Kauś.46.54c.
bhadram uttarato vada # RVKh.2.43.1b; Kauś.46.54b; N.9.5b.
bhadram upariṣṭān no vada # RVKh.2.43.3b.
bhadraṃ purastān no vada # RVKh.2.43.1c; Kauś.46.54c; N.9.5c.
bhadraṃ-bhadraṃ na ā bhara (RVKh. vada) # RV.8.93.28a; RVKh.2.43.3c; SV.1.173a.
bhadrā agner vadhryaśvasya saṃdṛśaḥ # RV.10.69.1a. Cf. BṛhD.7.107.
bharti svadhāvāṃ opaśam iva dyām # RV.1.173.6d.
bhavā dyumnī vādhryaśvota gopāḥ # RV.10.69.5a.
bhavā maghavan maghavadbhyaḥ śarma # RV.1.58.9b.
bhaviṣyad asi # śś.8.21.3. See bhavad asi.
bhāgyo bhavad atho annam adad bahu # AVś.10.8.22a.
bhuvat svādhīr hotā havyavāṭ # RV.1.67.2b.
bhuvad vājāyi bhuvad vājeṣu # Lś.2.10.18.
bhuvad vājeṣv avitā bhuvad vṛdhaḥ # RV.6.48.2c; SV.2.54c; VS.27.44c; MS.2.13.9c: 159.13; KS.39.12c; Apś.17.9.1c.
bhuvad vājeṣv avitā bhūvād dhiṃ māyi vārdhā # JB.1.177. Variation of the preceding mantra.
bhuvaḥ svāhā # MS.4.9.12: 134.3; JB.1.358 (bis); KB.6.12; ṣB.1.5.8; śB.14.9.3.7,12; BṛhU.6.3.7,12; ChU.4.17.5; Aś.1.11.13; śś.3.21.3; Lś.4.11.4; Mś.3.1.1; Kauś.5.13; 91.7; ApMB.1.10.10--13 (ApG.3.8.10); 2.12.11--14 (ApG.6.15.4); 2.22.22 (ApG.8.23.9); JG.1.3,4,12. See oṃ bhuvas svāhā, and cf. oṃ bhuvaḥ svadhā.
bhuvo viśvam abhy adevam ojasā # SV.1.466f. See bhuvad viśvam.
bhūtaṃ ca stha bhavyaṃ ca stha # KS.39.1; Apś.16.33.1. Cf. bhūtam asi bhavad.
bhūtam asi bhavad asi # Kauś.92.13a. Cf. bhūtaṃ ca stha.
bhūtāny upāvadhīḥ # Apś.10.2.11.
bhūmiś ca viśvadhāyasaṃ bibharti # RV.7.4.5d.
bhūmyāḥ pṛṣṭhe vada (AVP. adds bahu) rocamānaḥ # AVś.5.20.6b; AVP.9.27.7b.
bhūyāsam asya svadhayā prayoge # RVKh.10.151.9d.
bhūri poṣaṃ sa dhatte vīravad yaśaḥ # RV.8.23.21c.
bhūḥ (ApMB. bhū) svāhā # VS.20.12,23; MS.3.11.8: 151.15; 3.11.10: 157.14; 4.9.11: 132.12; 4.9.12: 134.3; KS.38.4,5; JB.1.358; KB.6.12; ṣB.1.5.8; śB.12.8.3.30; 14.9.3.7,11; TB.2.1.9.3; 6.5.8; 6.5; TA.4.10.5; 5.8.11; BṛhU.6.3.7,11; Aś.1.11.13; śś.3.21.2; Lś.4.11.4; Apś.9.8.4; 15.11.9; 19.10.7; Mś.3.1.1; 5.2.11.24; 9.2.3.24; Kauś.5.13; 91.6; ApMB.1.10.10--13 (ApG.3.8.10); 2.12.11--14 (ApG.6.15.4); 2.22.21 (ApG.8.23.9); JG.1.3,4,12; VārG.1.29; 14.12. See oṃ bhūs svāhā, and cf. oṃ bhūḥ svadhā.
bhoḥ # MG.1.9.12; VāDh.13.46.
bhojā jigyur vadhvaṃ yā suvāsāḥ # RV.10.107.9b.
maṃhiṣṭhasya prabhṛtasya svadhāvaḥ # RV.1.147.2b; VS.12.42b; TS.4.2.3.4b; MS.2.7.10b: 88.15; KS.16.10b; śB.6.8.2.9.
makhaḥ sahasvad arcati # RV.1.6.8b; AVś.20.40.2b; 70.4b.
majjānaṃ mṛtyor juhomi majjabhir mṛtyuṃ vāsaye # VāDh.20.26.
matsad ahiṃ vṛtram apāṃ jinvad udāryam udyān divi samudraṃ parvatāṃ iha # Aś.6.2.11.
madeṣu sarvadhā asi # RV.9.18.1c--7c; SV.1.475c; 2.443c,444c,445c; JB.3.159c (ter).
madhumatīm adya devebhyo vācaṃ vadiṣyāmi cāruṃ manuṣyebhyaḥ # śś.1.5.9. See prec. but one.
madhu vātā ṛtāyate # RV.1.90.6a; VS.13.27a; TS.4.2.9.3a; 5.2.8.6; MS.2.7.16a: 99.18; KS.39.3a; śB.7.5.1.4; 14.9.3.11a; TA.10.10.2a; 49.1a; BṛhU.6.3.11a; MahānU.9.8a; 17.7a; Apś.16.25.1; Mś.6.1.7.22; 11.9.2.3,5; AG.1.24.15; Kauś.90.25; 91.1a; 118.1; MG.1.9.14; VārG.11.16. Ps: madhu vātāḥ Vait.29.1; Kś.17.4.27; YDh.1.238; VHDh.8.29; madhu Rvidh.1.21.1. Cf. PG.1.3.21; GDh.15.28; ApDh.2.7.17.22; BDh.2.8.14.5; VāDh.28.13; YDh.1.219; BṛhD.3.123.
madhu svādma duduhe jenyā gauḥ # RV.3.31.11d.
madhyā yat kartvam abhavad abhīke # RV.10.61.6a.
madhye divaḥ svadhayā mādayante (RV.1.108.12b, mādayethe) # RV.1.108.12b; 10.15.14b; AVś.18.2.35b; VS.19.60b.
madhvaḥ svādiṣṭham īṃ piba # RV.8.49 (Vāl.1).4b.
madhvā samañjan svadayā sujihva # RV.10.110.2b; AVś.5.12.2b; VS.29.26b; MS.4.13.3b: 201.10; KS.16.20b; TB.3.6.3.1b; N.8.6b.
mana upāvadhīḥ # Apś.10.2.11.
manasā vā ye 'vadann ṛtāni # AVś.7.1.1b; śś.15.3.7b.
manunā kṛtā svadhayā vitaṣṭā # TS.1.1.2.1b; MS.1.1.2b: 1.6; 4.1.2: 2.17; KS.1.2b; 31.1; TB.3.2.2.2b.
manuṣvad agne aṅgirasvad aṅgiraḥ # RV.1.31.17a.
manuṣvad deva dhīmahi pracetasam # RV.1.44.11c. See vanuṣvad.
manotāyai haviṣo 'vadīyamānasyānubrūhi # TS.6.3.10.3; Kś.6.8.9; Apś.7.24.1; Mś.1.8.5.17. P: manotāyai haviṣaḥ śś.5.19.13. Cf. MS.3.10.2: 132.11 ff.; śB.3.8.3.14.
mantrair agniṃ kavim achā vadāmaḥ # RV.10.88.14b.
mandra svadhāva ṛtajāta sukrato # RV.1.144.7b. Cf. prec. but two.
mandhātṛvad aṅgirasvad avāci # RV.8.40.12b.
manmā dīdhyānā utā naḥ sakhāyā # MS.4.9.12b: 133.7. See under anvādīdhyāthām.
mamaitān putro mahatā vadhena # RV.4.18.7c.
mayā prattaṃ svadhayā madadhvam # JG.2.1b,1d (bis),2d. See under tayā prattaṃ.
mayi svadhṛtiḥ (JG. adds svāhā) # Lś.3.8.12; SMB.1.3.14; JG.1.22.
mayūkha ivādhi bhūmyām # AVP.4.5.9d.
mayeṣitau vi sṛjatāṃ vadhāya # AVP.8.9.13d.
marudbhya svatavadbhyaḥ # JB.2.176 (bis).
marudbhyaḥ svatavadbhyo 'nusṛṣṭān # VS.24.16; MS.3.13.14: 171.7; Apś.20.14.10.
martaṃ śaṃsaṃ viśvadhā veti dhāyase # RV.1.141.6d.
martyān martyebhyo adhi nirvadantīm # AVP.7.9.7e.
mahad brahma vadiṣyati # AVś.1.32.1b; AVP.1.23.1b.
mahase vīṇāvādam # VS.30.19; TB.3.4.1.13.
mahāṃ asunvato vadhaḥ # RV.8.62.12c.
mahāṃ (MSṃś. mahaṃ) indro nṛvad ā carṣaṇiprāḥ # RV.6.19.1a; VS.7.39a; TS.1.4.21.1a; MS.1.3.25a: 38.12; KS.4.8a; AB.5.18.14; KB.21.4; 26.12; śB.4.3.3.18a; TB.3.5.7.4a. Ps: mahāṃ (Mś. mahaṃ) indro nṛvat Aś.6.7.6; 8.7.22; śś.1.8.13; 10.10.5; 11.9.4; 17.9.5; Mś.2.4.6.17; mahāṃ indraḥ Kś.10.3.10.
mahān kavir niś carati svadhāvān # RV.1.95.4d; AVP.8.14.4d.
mahi trīṇām avo 'stu (SV. avar astu) # RV.10.185.1a; SV.1.192a; VS.3.31a; MS.1.5.4a: 70.7; 1.5.11: 79.9; KS.7.2a,9; śB.2.3.4.37a; Apś.6.17.10a; Mś.1.6.2.11; MG.1.5.4; Rvidh.4.23.3. P: mahi trīṇām śś.12.2.14; AG.3.10.7; Svidh.2.1.5. Cf. BṛhD.8.86; Rvidh.2.31.6. Designated as māhitram (sc. sūktam) VāDh.26.5; BṛhD.8.86.
mahiṣīva tvad rayiḥ # RV.5.25.7c; SV.1.86c; VS.26.12c; TS.1.1.14.4c; KS.39.14c; JB.3.269c.
mahīva dyaur adha (AVś. vadha) tmanā # RV.10.133.5d; AVś.6.6.3d.
mahe cana tvām adrivaḥ (SV. tvādri-) # RV.8.1.5a; SV.1.291a; śś.18.9.2; 10.2.
mahyaṃ śriyaṃ vada # RVKh.10.151.6d.
mahyaṃ tvādād bṛhaspatiḥ # RVKh.10.85.6b; AVś.14.1.52b; PG.1.8.19b; ApMB.1.8.9b.
mahyaṃ tvādur gārhapatyāya devāḥ # RV.10.85.36d; AVś.14.1.50d; SMB.1.2.16d; PG.1.6.3d; ApMB.1.3.3d; HG.1.20.1d; MG.1.10.15f; JG.1.21d; VārG.14.13d.
mahyaṃ medhāṃ vada # RVKh.10.151.6c.
māṃścatve vā pṛśane vā vadhatre # RV.9.97.54b; SV.2.456b.
māṃsaṃ mṛtyor juhomi māṃsena mṛtyuṃ vāsaye # VāDh.20.26.
mā gām anāgām aditiṃ vadhiṣṭa # RV.8.101.15d; TA.6.12.1d; Kauś.92.14d; SMB.2.8.15d; PG.1.3.27d; ApMB.2.10.10b; HG.1.13.12d; MG.1.9.23d; JG.1.19d; VārG.11.23d.
mā ca tvā dviṣato (?) vadhīt # JG.1.12d. Cf. prec.
mā chido mṛtyo mā vadhīḥ # TA.3.15.1a; Tā.10.51a.
mā jyeṣṭhaṃ vadhīd ayam agna eṣām # AVś.6.112.1a. P: mā jyeṣṭham Kauś.46.26.
mātāmahāṃs (and mātāmahīḥ) svadhā namas tarpayāmi # BDh.2.5.10.1.
mātuḥ pitāmahān (also pitāmahīḥ, prapitāmahān, and prapitāmahīḥ) svadhā namas tarpayāmi # BDh.2.5.10.1.
mātṝḥ svadhā namas tarpayāmi # BDh.2.5.10.1.
mā te kumāraṃ rakṣo vadhīt # ApMB.2.13.1a (ApG.6.15.5). See mā te putraṃ.
mā te mano viṣvadryag (TS. -driyag) vi cārīt # RV.7.25.1d; TS.1.7.13.2d; MS.4.12.3d: 186.3; KS.8.16d.
mā tvaṃ rudaty (ApMBḥG.JG. vikeśy) ura ā vadhiṣṭhāḥ # SMB.1.1.13c; ApMB.1.4.9c; HG.1.19.7c; JG.1.20c.
mā tvad yoṣam # VārG.11.8. Cf. HG.1.12.17.
mā tvad rāṣṭram (KS. yajño) adhi bhraśat # RV.10.173.1d; AVś.6.87.1d; VS.12.11d; KS.35.7d; śB.6.7.3.7; TB.2.4.2.8d; 7.15.4d. See under asmin rāṣṭram adhi.
mā tvādāmāna ā dabhan maghonaḥ # RV.6.44.12d.
mā tvā divyāśanir vadhīt # AVś.6.142.1d.
mā tvā vadhiṣur menibhiḥ piśācāḥ # AVP.14.5.9d.
mā tvā śyena ud vadhīn mā suparṇaḥ # RV.2.42.2a. See next.
mā tvā samudra ud vadhīn (VS. badhīn) mā suparṇaḥ # VS.13.16c; TS.4.2.9.1c; MS.2.17.15: 98.5; KS.16.16; śB.7.4.2.5.
mā devānāṃ yūyupāma (AVP. yūyavad) bhāgadheyam # AVP.12.18.1d; 15.22.3d; MS.1.2.7d: 16.11. See mā devānāṃ mithuyā.
mā na indra yavaṃ vadhīḥ # AVP.15.22.9c; 15.23.12f.
mā na indrābhitas tvad ṛṣvāriṣṭāsaḥ # TB.2.7.16.2a. See under na te ta indrā-.
mā naḥ pathaḥ pitṛyān mānavād adhi # RV.8.30.3c.
mā naḥ purā jaraso 'savo vadhiṣṭha # AVP.1.97.1b.
mā naḥ samaraṇe vadhīḥ # RV.1.170.2d.
mā no gām aśvaṃ puruṣaṃ vadhīḥ # AVś.10.1.29b.
mā no devā ahir vadhīt # AVś.6.56.1a; Kauś.139.8. P: mā no devāḥ Vait.29.10; Kauś.50.17.
mā no rudrāso adhigur vadhe nu # Mś.2.5.4.24d. See mā rudriyāso.
mā no vadhāya hatnave # RV.1.25.2a.
mā no vadhīḥ pitaraṃ mota mātaram # RV.1.114.7c; VS.16.15c; TS.4.5.10.2c; Tā.10.52c; Mś.3.1.28c. See mā ho hiṃsīḥ pitaraṃ.
mā no vadhīd abhibhā etc. # see mā no vidad etc.
mā no vadhīr indra mā parā dāḥ # RV.1.104.8a. Cf. next.
mā no vadhī rudra mā parā dāḥ # RV.7.46.4a. Cf. prec.
mā no vadhīr vidyutā deva sasyam # AVś.7.11.1c. Cf. mā no hiṃsīr divyenāgninā.
mā no vadhair varuṇa ye ta iṣṭau # RV.2.28.7a; MS.4.14.9a: 229.5.
mā no vidad (KS. vadhīd) abhibhā mo aśastiḥ # AVś.1.20.1c; 5.3.6c; KS.40.10c; TB.3.7.5.12c; Apś.2.20.6c.
mā no vidhīḥ etc. # see mā no vadhīḥ etc.
mā no vīrān rudra bhāmino vadhīḥ # VS.16.16c. See vīrān mā.
mā no hārdi tviṣā vadhīḥ # RV.8.79.8c.
mā no hiṃsīḥ pitaraṃ mātaraṃ ca # AVś.11.2.29c. See mā no vadhīḥ.
mā no hiṃsīr divyenāgninā sasyāṃ (followed by y-, read sasyān) # AVP.15.22.5c. Cf. mā no vadhīr vidyutā.
mā mānuṣīr avasṛṣṭā vadhāya # AVś.17.1.28d.
māmṛṣad eva (read deva ?) barhiḥ svāsasthaṃ tvādhyāsadeyam ūrṇamradam anabhiśokam # Kauś.3.7; 137.39. Cf. deva barhiḥ svā-.
mā me dīkṣāṃ mā tapo nir vadhiṣṭa (Kś. ba-) # TS.3.1.1.3; Kś.25.11.22; Mś.2.1.2.36.
mā me hārdi tviṣā (Mś. hārdiṃ dviṣā) vadhīḥ # TS.3.2.5.2b; Mś.2.4.1.39b.
mā vo ratho madhyamavāḍ ṛte bhūt # RV.2.29.4c.
mā sīm avadya ā bhāk # RV.8.80.8a.
māsma dakṣiṇato vadaḥ # TA.4.32.1b.
māsmākaṃ puruṣān vadhīḥ # AVP.2.70.3d.
mā svadhitis tanva (TS. tanuva) ā tiṣṭhipat te # RV.1.162.20b; VS.25.43b; TS.4.6.9.4b; KSA.6.5b.
māhaṃ tvad vyavachitsi # śś.2.12.9.
mitrāya havyaṃ ghṛtavaj juhota (KS. ghṛtavad vidhema) # RV.3.59.1d; KS.35.19d; Mś.3.2.8d; N.10.22d. See satyāya havyaṃ.
mukhān me vadvadān ghorān # SMB.2.5.2c.
mumuktam asmān gṛbhītād avadyāt # AVP.6.11.7c. See under next but one.
mumuktam asmān duritād avadyāt # AVś.5.6.8a. See prec. but one, and cf. pra ṇo muñcataṃ.
muhur gṛdhyaiḥ pra vadati # AVś.12.2.38a.
mūlaṃ nakṣatram iti yad vadanti # TB.3.1.2.3b.
mṛgaḥ sṛtiṃ yati dhāvād ajuṣṭām # AVś.10.3.6b.
mṛḍatā no maruto mā vadhiṣṭana # RV.5.55.9a.
mṛḍā no abhi cid vadhād vivakṣase # RV.10.25.3d.
mṛtyus tad abhavad dhātā (read dhotā ?) # TB.3.12.9.6c.
mṛtyo anavadharṣyam # AVś.8.2.10b.
mṛtyo mā puruṣaṃ vadhīḥ # AVś.8.2.5d.
mṛtyo mṛtyunā saṃvadasva # TA.4.28.1; HG.1.16.20.
mṛtyor ojīyaso vadhāt # AVś.10.3.7c.
medasvatīṃ ghṛtavatīṃ svadhāvatīm # HG.2.15.2c.
medo mṛtyor juhomi medasā mṛtyuṃ vāsaye # VāDh.20.26.
medhāvinaṃ brahmacaryopapannam # ViDh.29.10b; VāDh.2.9b; N.2.4b.
meniḥ śatavadhā hi sā # AVś.12.5.16a.
memaṃ prāpat pauruṣeyo vadho yaḥ # AVś.1.30.1d; AVP.1.14.1d.
memaṃ mitrā vadhiṣur mo amitrāḥ # AVś.2.28.3d. See mainaṃ mitrā etc.
memā bhavo mā śarvo vadhīd gāḥ # AVP.5.15.3a.
mainaṃ mitrā vadhiṣur mo amitrāḥ # AVP.1.12.4d. See memaṃ mitrā etc.
ya ātṛṇatty (SaṃhitopaniṣadB. ātṛṇoty) avitathena (VāDh. avidathena) karṇau # SaṃhitopaniṣadB.3a; VāDh.2.10a; N.2.4a. See ya āvṛṇoty.
ya āśvaśvā amavad vahante # RV.5.58.1c.
ya imaṃ yajñaṃ svadhayā dadante (śś. bhajante) # VS.8.61b; TS.1.5.10.4b; śś.13.12.13b. See under imaṃ yajñaṃ svadhayā.
ya u cānṛtavādinaḥ # TA.6.5.3d.
ya ūrdhvayā svadhvaraḥ # RV.1.127.1d; AVś.20.67.3d; SV.1.465d; 2.1163d; VS.15.47d; TS.4.4.4.8d; MS.2.13.8d: 158.4; KS.26.11d; 39.15d.
yaḥ prāsuvad vasudhitī # śś.8.18.1.
yaṃ yuvaṃ dāśvadhvarāya devā # RV.6.68.6a.
yaṃ śevadhim āvahāj jātavedāḥ # AVś.6.123.1b. See yam āvahāc.
yaṃ hutādam agniṃ yam u kāmam āhuḥ # Apś.16.35.1a. See yo devo viśvād, and viśvādam agniṃ.
yajā svadhvaraṃ janam # RV.1.45.1c; SV.1.96c.
yajñaś catuṣpād divam udvadeha (?) # GB.1.5.25d.
yajñasya ketuḥ pavate svadhvaraḥ # RV.9.86.7a.
yatasrucaḥ surucaṃ viśvadevyam # RV.3.2.5c.
yato naḥ pruṣṇavad vasu # RV.3.13.4c.
yat kiṃ ca duritaṃ mayi # RV.1.23.22b; 10.9.8b; VSK.6.5.5b; TA.10.24.1e,25.1e; MahānU.14.3e,4e. See under avadyaṃ ca.
yat kiṃ ca padvad āsanvat # AVP.6.21.3c.
yat kiṃ cāhaṃ tvāyur idaṃ vadāmi # RV.6.47.10c.
yat kiṃ cid (Mś. var. lect. ca) duritaṃ mayi # Tā.10.64d; MahānU.19.1d; Mś.1.8.4.40b. See under avadyaṃ ca.
yat te 'nādhṛṣṭaṃ nāma yajñiyaṃ (KS. nāmānādhṛṣyaṃ; MS. dhāmānādhṛṣyaṃ) tena tvādadhe # VS.5.9 (ter); TS.1.2.12.1 (bis); MS.1.2.8 (ter): 17.10,12,15; KS.2.9 (bis); 7.14; śB.3.5.1.32.
yat te śikvaḥ parāvadhīt # Apś.7.9.9a. See yat tvā śikvaḥ.
yat te śukra śukraṃ varcaḥ śukrā tanūḥ śukraṃ jyotir ajasraṃ tena me dīdihi tena tvādadhe # TB.1.1.7.2; 2.1.24; Apś.5.12.1. See next, and next but two.
yat te śukra śukraṃ jyotiḥ śukraṃ dhāmājasraṃ tena tvādadhe # MS.1.6.2: 87.7; 1.6.7: 97.12; Mś.1.5.4.13. See prec. and next but one.
yat te śukra śukraṃ dhāma śukrā tanūś śukraṃ jyotir ajasraṃ yat te 'nādhṛṣṭaṃ nāmādhṛṣyaṃ tena tvādadhe # KS.7.14. See under prec. but two.
yat tvā śikvaḥ parāvadhīt # AVś.10.6.3a. P: yat tvā śikvaḥ Vait.10.3; Kauś.8.13. See yat te śikvaḥ.
yat pārśvād uraso me # Kauś.58.1a.
yat prāṅ pratyaṅ svadhayā yāsi śībham # AVś.13.2.3a.
yatra grāvā vadati tatra gachatam # RV.1.135.7b.
yatra tvāchāvadāmasi # AVś.6.142.2b.
yatra vayaṃ vadāmasi (HG. vadāmaḥ) # ApMB.2.13.5b; HG.2.4.5b.
yatrāghāṭāḥ karkaryaḥ saṃvadanti # AVś.4.37.4d. See āghāṭāḥ.
yat sīm upa śravad giraḥ # RV.6.45.23c; AVś.20.78.2c; SV.2.1017c.
yat suvāco vadathanādhy apsu # RV.7.103.5d.
yathāgamaprajñāśrutismṛtivibhavād anukrāntamānād avivādapratiṣṭhād abhayaṃ śaṃ bhave no astu # śG.6.6.16.
yathāgnir akṣito 'nupadasta evaṃ mahyaṃ pitre 'kṣito 'nupadasta svadhā bhava (HG. -dastaḥ svadhā bhavatām) # ApMB.2.19.14; HG.2.13.1. Cf. pṛthivī darvir.
yathā carāṇi sarvadā # AVP.8.20.9c.
yathā jīvo vidatham āvadāsi # AVP.2.19.1d--4d. Cf. atha jīvāso.
yathā tvaṃ sūryāsi viśvadarśata evam ahaṃ viśvadarśato bhūyāsam # MS.4.6.6: 89.2; Apś.13.16.9. Fragment: evam ahaṃ viśvadarśato bhūyāsam Mś.2.5.2.26.
yathādityo 'kṣito 'nupadasta evaṃ mahyaṃ prapitāmahāyākṣito 'nupadasta (HG. -taḥ) svadhā bhava (HG. bhavatām) # ApMB.2.19.16; HG.2.13.1. Cf. dyaur darvir.
yathā putraḥ pravāvadaḥ # AVP.9.4.4a.
yathā mad adharaṃ vadān # RV.10.166.3d.
yathā varcasvān samitim āvadāni # AVP.10.6.4d.
yathāvaśo na vādiṣaḥ # AVś.6.42.3c; 43.3c.
yathā vāyur akṣito 'nupadasta evaṃ mahyaṃ pitāmahāyākṣito 'nupadasta (HG. -taḥ) svadhā bhava (HG. bhavatām) # ApMB.2.19.15; HG.2.13.1. Cf. antarikṣaṃ darvir.
yathā vo 'haṃ cārutamaṃ vadāni # PB.1.3.9d.
yathā śevadhir nihitaḥ # AVś.12.4.14a.
yathāham uttaro vadāmi # HG.1.15.5c.
yathaiva te na guror bhojanīyāḥ # VāDh.2.11c; N.2.4c.
yad akṣeṣu vadā yat samityām # AVś.12.3.52a. P: yad akṣeṣu Kauś.63.1.
yad antaḥ samudre kavayo vadanti # MahānU.1.3c. See yam antaḥ.
yad avadānāni te 'vadyan # TB.3.7.5.5a; Apś.2.19.6a; Mś.1.3.2.13a.
yadā bhaṅgyaśvinau vadataḥ # Apś.21.20.3a.
yadāyukta tmanā svād adhi ṣṇubhiḥ # RV.5.87.4c.
yadārāghaṭī varadaḥ (Mś. yadā rāghārādyaṃ [?] vadataḥ; Apś. yadā rākhāṭyau vadataḥ) # Mś.7.2.7.10a; Vait.34.9a; Apś.21.20.3a.
yad āśasā vadato me vicukṣubhe # AVś.7.57.1a. P: yad āśasā Kauś.46.6.
yadi dakṣiṇato vadāt # TA.4.32.1c.
yad indrāhaṃ yathā tvam # RV.8.14.1a; AVś.20.27.1a; SV.1.122a; 2.1184a; ā.5.2.5.2; śś.18.13.5; Vait.31.22; 32.4; Svidh.1.3.6. P: yad indrāham Aś.6.4.10. Cf. BṛhD.1.55. Designated as gosūktam VāDh.28.14; ViDh.56.18; LAtDh.3.14; VAtDh.3.14.
yadi me śṛṇavad dhavam # RV.8.61.10b.
yadi stutaṃ yadi vādya suṣṭutam # Lś.2.1.6a.
yadi stotur maghavā śṛṇavad dhavam # RV.8.33.9c; AVś.20.53.3c; 57.13c; SV.2.1048c.
yad īṃ mṛgāya hantave mahāvadhaḥ # RV.5.34.2c.
yad utpatan vadasi karkarir yathā # RV.2.43.3c; Kauś.46.54c.
yad ulūko vadati mogham etat # RV.10.165.4a; AVś.6.29.1b; MG.2.17.1a.
yad ūvadhyam udarasyāpavāti # RV.1.162.10a; VS.25.33a; TS.4.6.8.4a; MS.3.16.1a: 182.12; KSA.6.4a.
yadottamat tantubaddhāya nāvadvāsaḥ pūrvayāvat pururūpapeśaḥ # AVP.15.6.6ab.
yad gopāvad aditiḥ śarma bhadram # RV.7.60.8a.
yad gomāyū vadato jātavedaḥ # Kauś.96.3a.
yad goṣṭhe yac ca śevadhau # AVP.6.15.4b.
yad brahmāvādiṣma tan mā mā hiṃsīt # KA.1.219L.
yady anyadhīyate pūrvadhīyate taṃ pratigrāmanty ahāni pañcaviṃśatir yair vai saṃvatsaro mitaḥ # Aś.8.13.31 (corrupt).
yad vāg vadanty avicetanāni # RV.8.100.10a; TB.2.4.6.11a; Aś.3.8.1; N.11.28a. Ps: yad vāg vadantī TB.2.8.8.4; śś.9.28.6 (comm.); yad vāk Rvidh.2.35.2. Cf. BṛhD.6.121.
yad vā ghā satyam uta yan na vidma # RV.5.85.8b; 10.139.5c; TS.3.4.11.6b; MS.4.14.3b: 218.14; KS.23.12b. See yad vādya.
yad vām aśvāvad īmahe # RV.7.94.9b; KS.4.15b; Kauś.5.2b.
yad vā vadā anṛtaṃ vittakāmyā # AVś.12.3.52b.
yad vāsi rocane divaḥ # RV.8.97.5a. Cf. yad vādo.
yad vā svadhābhir adhitiṣṭhato ratham # RV.8.10.6c.
yad vā svarau svadhitau riptam (MS. ripram) asti # RV.1.162.9b; VS.25.32b; TS.4.6.8.4b; MS.3.16.1b: 182.14; KSA.6.4b.
yaṃ te suṣāva haryaśvādriḥ # RV.7.22.1b; AVś.20.117.1b; SV.1.398b; 2.277b; TS.2.4.14.3b; PB.12.10.1b. P: yaṃ te suṣāva śś.10.5.11,13.
yaṃ te svadāvan svadanti gūrtayaḥ # RV.8.50 (Vāl.2).5c. Cf. next.
yaṃ te svadhāvan svadayanti dhenavaḥ # RV.8.49 (Vāl.1).5c. Cf. prec.
yaṃ tvā pūrvam īḍito vadhryaśvaḥ # RV.10.69.4a.
yaṃ tvām ayaṃ (TS.KS. tvāyaṃ) svadhitis tejamānaḥ (TS.KS. tetijānaḥ; MS. tigmatejāḥ) # RV.3.8.11c; TS.1.3.5.1c; MS.1.2.14a: 23.7; KS.3.2a; 26.3. P: yaṃ tvām ayam Mś.1.8.1.10. See ayaṃ hi tvā.
yamāya ghṛtavad dhaviḥ (AVś. -vat payaḥ) # RV.10.14.14a; AVś.18.2.3a; TA.6.5.1a.
yamāya pitṛmate svadhā namaḥ # AVś.18.4.74. P: yamāya pitṛmate Kauś.88.4. See yamāyāṅgirase.
yamāyāṅgirase svadhā namaḥ # ViDh.21.8. See yamāya pitṛmate.
yamāyāṅgirasvate pitṛmate svāhā (ApśṃśḥGṃG. svadhā namaḥ; BDh. svadhā namaḥ svāhā) # śś.4.4.1; Apś.1.8.4; Mś.11.9.1.7; HG.2.10.7; MG.2.9.13; BDh.2.8.14.7. Cf. under yamāya tvāṅgirasvate.
yam āvahāc chevadhiṃ jātavedāḥ # AVP.2.60.4b; VS.18.59b; TS.5.7.7.1b; KS.40.13b; śB.9.5.1.46; Mś.2.5.5.21b. See yaṃ śevadhim.
yam eva vidyāḥ śucim (VāDh. sucim) apramattam # ViDh.29.10a; VāDh.2.9a; N.2.4a.
yaṃ me datto brahmabhāgaṃ vadhūyoḥ # AVś.14.2.42a.
yayā rūpāṇi bahudhā vadanti # TB.2.5.1.2a.
yas ta āhutaś carati svadhābhiḥ (AVś. -dhāvān) # RV.10.16.5b; AVś.18.2.10b; TA.6.4.2b.
yas tṛtīyasyāṃ pṛthivyām asi yat te 'nādhṛṣṭaṃ nāma yajñiyaṃ tena tvādadhe # VS.5.9.
yas te adya kṛṇavad bhadraśoce # RV.10.45.9a; VS.12.26a; TS.4.2.2.3a; MS.2.7.9a: 87.1; KS.16.9a; ApMB.2.11.28a (ApG.6.15.1).
yas te anu svadhām asat # RV.3.51.11a; SV.2.88a.
yas te gandhaḥ pṛthivi saṃbabhūva # AVś.12.1.23a. Designated as gandhapravādāḥ (sc. ṛcaḥ) Vait.10.15; Kauś.13.12; 54.5.
yas te na druhyet katamac canāha # ViDh.29.10c; VāDh.2.9c; N.2.4c.
yas te havaṃ vivadat (AVP. paritiṣṭhāt) # AVś.3.3.6a; AVP.2.74.6a.
yas tvad dhotā pūrvo agne yajīyān # RV.3.17.5a.
yas tvā dadāti prathamāṃ svadhānām # AVP.5.31.5b.
yasmāt pakvād amṛtaṃ saṃbabhūva # AVś.4.35.6a.
yasmin vṛkṣe madhvadaḥ suparṇāḥ # RV.1.164.22a; AVś.9.9.21a.
yasmai grāvāṇaḥ pravadanti nṛmṇam # AVś.4.24.3b. See yasya grāvāṇaḥ.
yasya grāvāṇaḥ pravadanti nṛmṇe # AVP.4.39.2b. See yasmai grāvāṇaḥ.
yasya te svādu sakhyam # RV.8.68.11a.
yasya prasvādaso giraḥ # RV.10.33.6a. Cf. BṛhD.7.36.
yasya svādiṣṭhā sumatiḥ pitur yathā # RV.8.86.4c.
yasyāṃ pūrvam avadad deva ekaḥ # AVP.1.92.1b.
yasyeme lokāḥ svadhayā samaktāḥ # AVP.6.22.11b.
yaḥ satyavādy ati taṃ sṛjantu (AVP. -nti) # AVś.4.16.6d; AVP.5.32.1d.
yaḥ suhotā svadhvaraḥ # RV.8.103.12c; SV.1.110c.
yā atra pitaraḥ svadhā yuṣmākaṃ sā # śś.4.5.1.
yā ātmanvad bibhṛto (KS. -tho) yau ca rakṣataḥ (KS. -thaḥ) # MS.3.16.5b: 191.2; KS.22.15b. See yāv etc.
yāḥ prācīḥ saṃbhavanty āpa uttarataś ca yā adbhir viśvasya bhuvanasya dhartrībhir antar anyaṃ pitur dadhe svadhā namaḥ # HG.2.10.7.
yāṃ rakṣanty asvapnā viśvadānīm # AVś.12.1.7a; MS.4.14.11a: 233.12.
yāgre vāk samavadata # MG.1.10.15a. Cf. ūrdhvā vāk samabhavat and PG.1.7.2.
yāṃ kalpayanti vahatau vadhūm iva # AVś.10.1.1a. P: yāṃ kalpayanti Kauś.39.7; Rvidh.4.6.3. Designated as kṛtyāsūkta Rvidh.4.8.4.
yā caturdhā pravadati agnau # VārG.13.3a.
yā jīvadhanyā dhanam ut pṛṇanti # AVP.14.1.10a.
yā te 'vadīptir avarūpā jātavedaḥ # Kauś.130.2a.
yātra pitaraḥ svadhā tayā yūyaṃ mādayadhvam # Mś.1.1.2.23. See next.
yātra pitaras svadhā yatra yūyaṃ stha sā yuṣmāsu tayā yūyaṃ yathābhāgaṃ mādayadhvam # KS.9.6. See prec.
yātra svadhā pitaras tāṃ bhajadhvam # JG.2.1d.
yāṃ te kṛtyāṃ kūpe 'vadadhuḥ # AVś.5.31.8a.
yāṃ tvāditir avapat # AVP.3.15.3a.
yābhis trimantur abhavad vicakṣaṇaḥ # RV.1.112.4c.
yām airayaṃś (TS. -yañ) candramasi svadhābhiḥ # VS.1.28c; TS.1.1.9.3c; śB.1.2.5.19. See tām etc.
yāvac ca sapta sindhavo vitasthire (TS. -tasthuḥ) # VS.38.26b; TS.3.2.6.1b. See yāvat sapta, and yāvad vā.
yāvat kṛṣṇo 'bhidhāvati # VāDh.1.15c.
yāvat taras tanvo yāvad ojaḥ # RV.7.91.4a; AB.5.18.8; KB.25.2; 26.11; Aś.8.10.1. P: yāvat taraḥ śś.10.10.4. Cf. BṛhD.6.18 (B).
yāvat taro maghavan yāvad ojaḥ # RV.1.33.12c.
yāvat sūryasya varcaḥ # AVś.3.22.4c. See yāvad varcaḥ.
yāvadaṅgīnaṃ pārasvatam # AVś.6.72.3a. P: yāvadaṅgīnam Kauś.40.17.
yāvad āpaḥ siṣyadur yāvad agniḥ # AVś.9.2.20b.
yāvad itaḥ purastād udayāti sūryas tāvad ito 'muṃ nāśaya yo 'smān dveṣṭi yaṃ ca vayaṃ dviṣmaḥ # TA.4.39.1.
yāvad dyāvāpṛthivī tāvad it tat # RV.10.114.8b; ā.1.3.8.7.
yāv ātmanvad viśatho (AVP. vidatho; TS. bibhṛto) yau ca rakṣathaḥ (TS. -taḥ) # AVś.4.25.1b; AVP.4.34.1b; TS.4.7.15.3b. See yā etc.
yā vaiśvadevīr iṣavo yā vasūnām # AVP.2.36.1a.
yāsāṃ mūlam udavadhīḥ sphyena # Apś.4.6.1c.
yās te agne śivās tanuvas tābhis tvādadhe # TB.1.1.7.3; 8.6; Apś.5.15.2.
yuvaṃ sindhūṃr abhiśaster avadyāt # RV.1.93.5c; TS.2.3.14.2c; MS.1.5.1 (only in Padap.; see p. 65, note 6); 4.10.1c: 144.15; KS.4.16c; AB.2.9.5c; TB.3.5.7.3c; Kauś.5.1c.
yuvaṃ havaṃ vadhrimatyā agachatam # RV.10.39.7c.
yūpo hy arukṣad dviṣatāṃ vadhāya # Kauś.125.2a.
ye adrogham anuṣvadham # RV.5.52.1c.
ye amī rocane divaḥ # MS.2.7.15a: 97.5. See ye cāmī, ye 'do, ye vādo, and ye vāmī.
ye aśvadā uta vā santi godāḥ # RV.5.42.8c.
ye aśvadāḥ saha te sūryeṇa # RV.10.107.2b.
Dictionary of Sanskrit Search
"vad" has 72 results
ananyavadbhāvabeing the same, being looked upon as not different. See अनन्य a reference to some preceding word, not necessarily on the same page..
antavadbhāvasupposed condition of being at the end obtained by the single substitute(एकादेश) for the final of the preceding and the initial of the succeeding word. confer, compare अन्तादिवच्च । योयमेकादेशः स पूर्वस्यान्तवत् परस्थादिवत् स्यात् । Sid. Kau. on अन्तादिवच्च P.VI. 1.84.
antādivadbhāvacondition, attributed to a single substitute for the final of the preceding and initial of the succeeding word, of being looked upon either as the final of the preceding word or as the initial of the succeeding word but never as both (the final as well as the initial) at one and the same time; confer, compare उभयत आश्रये नान्तादिवत् Sīr. Pari 39 also Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on I.2.48.
arthavadgrahaṇaparibhāṣāa well known maxim or Paribha of grammarians fully stated as अर्थवद्ग्रहणे नानर्थकस्य ग्रहणम्, deduced from the phrase अर्थवद्ग्रहणात् frequently used by the Vārttikakāra. The Paribhāṣā lays down that 'when a combination of letters employed in Grammar, is possessed of a sense, it has to be taken as possessed of sense and not such an one as is devoid of sense.'
avadhāraṇarestriction; limitation; confer, compare अवधारणमियत्तापरिच्छेदः । यावदमत्रं ब्राह्मणानामन्त्रयतस्व Kāś. on P.II.1.8.
avadhilimit,which is either exclusive or inclusive of the particular rule or word which characterizes it: confer, compare सर्वश्च हल् तं तमवधिं प्रति अन्त्यो भवति Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on I.3.3.
avadhimatobject of limit; confer, compare दूरे चेदवधिमान् अवधेर्भवति Kāś. on P.V.3.37.
avyavadhānaabsence of intervention between two things by something dissimilar; close sequence confer, compare अतज्जातीयकं हि लोके व्यवधायकं भवति Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on I.1.7. Vārttika (on the Sūtra of Pāṇini). 8; cf also येन नाव्यवधानं तन ब्यवहितेपि वचनप्रामाण्यात् Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on VII.3.44, VII.3.54, VII.4.l, VII.4.93. The term अव्यवाय is used in the same sense.
āsvadīyaa sub-division of the चुरादि (Xth conjugation) roots, beginning with the root ग्रस् and ending with the root स्वद्, which take the Vikaraṇa णिच् id est, that is which are conjugated like roots of the tenth conjugation, only if they are transitive in sense.
iṣṭhavadbhāvapossession of the same properties for causing grammatical operations as the taddhita affix. affix इष्ठन् possesses, as for instance, the elision of the syllable beginning with the last vowel ( टिलोप ), substitution of the masculine gender. base for the feminine. base (पुंवद्भाव) et cetera, and others, before the denom affix णिच्; exempli gratia, for example एतयति in the sense of एनीं आचष्टे; similarly प्रथयति, पटयति, दवयति, confer, compare M.Bh. on. P.VI.4. 155 Vārt, 1.
upadeśivadbhāvaoccurrence in the original statement before the application of any affixes et cetera, and others, confer, compare एवमप्युपदेशिवद्भावो वक्तव्यः, Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P.I. 1.56, Vārttika (on the Sūtra of Pāṇini). 23.
upadeśivadvacanastatement to the effect that a word should be looked upon as occurring in the original instruction although it is not there. See उपदेश.confer, compare नुम्विधावुपदेशिवद्वचनं प्रत्ययविध्यर्थम् P. VII.1.58. Vārttika (on the Sūtra of Pāṇini). 1.
karmavadbhāvathe activity of the agent or kartā of an action represented as object or karman of that very action, for the sake of grammatical operations: e. g. भिद्यते काष्ठं स्वयमेव;. करिष्यते कटः स्वयमेव. To show facility of a verbal activity on the object, when the agent or kartā is dispensed with, and the object is looked upon as the agent, and used also as an agent, the verbal terminations ति, त; et cetera, and others are not applied in the sense of an agent, but they are applied in the sense of an object; consequently the sign of the voice is not अ (शप्), but य (यक्) and the verbal terminations are त, आताम् et cetera, and others (तङ्) instead of ति, तस् et cetera, and others In popular language the use of an expression of this type is called Karmakartari-Prayoga. For details see Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on कर्मवत्कर्मणा तुल्यक्रियः P.III.1.87. Only such roots as are कर्मस्थक्रियक or कर्मस्थभावक id est, that is roots whose verbal activity is noticed in the object and not in the subject can have this Karmakartari-Prayoga.
kurvadrūpaeffective or efficient, as opposed to dormant, as applied to निमित्त (cause); confer, compareनिमित्तशब्दोयमस्ति योग्यतामात्रे । कुसुलस्थेष्वपि बीजेषु वक्तारो भवन्ति अङ्कुरनिमित्तान्येतानीति अस्ति च कुर्वद्रूपे । Padamañjarī, a commentary on the Kāśikāvṛtti by Haradatta. on P.VII.2.36.
keśavadattawriter of the commentary named दुर्धटोद्धाट on the grammar संक्षिप्तसार written by Goyicandra,
tadvadatideśatreatment of something as that which is not that e. g. the treatment of affixes not marked with mute n or n as marked with n even though they are not actually marked that way, confer, compare P. I. 2.14; also cf तद्वदतिदेशेSकिद्विधिप्रसङ्गः P. I. 2.1 Vart 4.
tṛjvadbhāvatreatment of a word as ending with the affix तृच् although, in fact, it does not so end; e. g. the word क्रोष्टु; confer, compare तृज्वत्क्रोष्टु:, P. VII. 1.95 ; confer, compare also तृज्वद्भावस्यावकाशः क्रोष्ट्रा क्रोष्टुना; M.Bh, on VII. 1.95 Vart. 10.
dravyavadbhāvabehaviour like a dravya as noticed in the case of the bhava or kriya found in a root after a krt afix is added to it confer, compare कृदभिहितो भावो द्रव्यवद्भवति. Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on II.2.19, III.1.67 et cetera, and others
nāvyavadhānanecessary intervention; confer, compare येन नाव्यवधानं तेन व्यवहितेपि वचनप्रामाण्यात्, a statement which is looked upon as a general statement of the ' nature of Paribhasa occurring in the Mahabhasya on P. VII. 2.3.
parāṅgavadbhāvabehaviour as having become a part and parcel of another ; treatment of a word as a part of another. The term is used by Panini in connection with a word followed by and connected with a word in the vocative case of which it is looked upon as a part for purposes of accent, e. g. कुण्डेनाटन् , मद्राणां राजन् et cetera, and others Here the words अटन् and राजन् , being in the vocative case, are अाद्युदात्त, id est, that is अ ( at the beginning of अटन्) and अा (in राजन्) are acute and as a result all the other vowels in कुण्डेनाटन् and मद्राणां राजन् become अनुदात्त or grave; confer, compare सुबामन्त्रिते पराङ्गवत्स्वरे P.II.1.2.
puṃvadbhāvarestoration of the masculine form in the place of the feminine one as noticed in compound words, formed generally by the Karmadhāraya and the Bahuvrīhi compounds, where the first member is declinable in all the three genders; e. g. दीर्घजङ्घः. This restoration to the masculine form is also noticed before the taddhita affix. affixes तस्, तर, तम्, रूप्य, पा​श, त्व as also before क्यङ् and the word मानिन्. For details, see P. VI, 3.34 to 42 and commentaries thereon. See also page 334, Vol. VII of the Pātańjala Mahābhāșya D. E. Society's edition.
bhavadevaa scholar of grammar who has written a commentary on the Brhacchabdaratna of Hari Diksita.
bhāvadīpaname of a commentary on the Ṡabdakaustubha by कृष्णमिश्र.
bhāvadevaa grammarian who has written a commentary on the Bŗhacchabdaratna of Hari Dīkșita; possibly the same as भवदेव.See भवदेव.
yuktavadbhāvaliterally behaviour like the original base. The term is used in the sense of possession of, or getting, the same gender and number as was possessed by the base to which the taddhita affix. affix was added and subsequently dropped by a rule of Panini in which the word लुप् is put in the sense of dropping: e. g. कुरयः देश: or अङ्गाः देश: in the sense of कुरूणां or अङ्गानां निवासो जनपदः confer, compare जनपदे लुप् P. IV.3.81 and लुपि युक्तवद् व्यक्तिवचने P.I.2.51;confer, compare also M.Bh. on P. I. 2.51 and 52.
lasārvadhātukaa personal ending substituted for ल् which in certain cases gets the grave accent in, spite of the general rule that affixes ( which include personal endings ) are acute; confer, compare तास्यनुदात्तेन्डिद्दुपदेशाल्लसार्वधातुकमह्न्विङोः P. VI. 1. 186.
vyañjanāvidyamānavadbhāvaconsideration of a consonant being not present as far as the accentuation of a vowel is concerned, the vowel being looked upon as the initial or the final, irrespective of the consonant .or consonants respectively preceding it, or following it; confer, compare स्वरविधौ व्यञ्जनमविद्यमानवद् भवति Par. Sek. Pari. 79.
vyapadeśivadbhāvatreatment of a secon dary thing as the principal one, e g. a person or a thing, without any second or any others, looked upon as the first or the last; confer, compare व्यपदेशिवदेकस्मिन् कार्ये भवतीति वक्तव्यम् Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. I. 1.21. Vart. 2. The remark or expression व्यपदेशिवद्भावेन भविष्यति is found often given in the Mahabhasya; confer, compare Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). Ahnika 1 Vart 14; I.1.9, I.1.51 I,1.72: I.2.48 et cetera, and others For details see Par. Sek. Pari. 30,
vyapadeśivadvacanastatement of Vyapadesivadbhava : confer, compare तत्र व्यपदेशिवद्वचनम् -एकाचो द्वे प्रथमार्थं षत्वे चादेशसंप्रत्ययार्थम् । Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on VIII.3.59 Vart. 7.
vyavadhāna(I)intervention; the word is used in connection with the intervention or occurrence of letters or phonetic units between the cause ( निमित्त ) of an operation and the operatee (विधिभाक् ); cf लोपे कृते नास्ति व्यवधानम् | स्थानिवद्भावाद् व्यवधानमेव | The word is used also in the sense of intervention in , general, which separates the two connected things; व्यवधानं च भवति वाक्ये राज्ञ ऋद्धस्य पुरुषः; the word व्यवाय is used in the same sense; confer, compare अट्कुप्वाङ्नुम्व्यवायेपि; (2) an inserted letter or phonetic element; confer, compare व्यवधानः अन्त्यविकारे T, Pr. 185, 186.
vyavadhāyakacausing an intervention; intervener which is required to be of a different kind; cf अतज्जातीयकं व्यवधायकं भवति Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. I. 1.7. Wart 8.
śluvadbhāvatreatment as before the elision named श्लु, i. e. reduplication of the preceding root. This श्लुवद्भाव is prescribed in the case of the roots भी, ह्री, भृ and हु; confer, compare भीह्रीभृहुवां श्लुवच्च P. III. 1. 39.
sanvadbhāvabehaviour like that of the affix सन् in point of its specific features, viz. causing reduplication in the case of the previous root.by the rule सन्यङोः VI.1.9, as also the substitution of इ for अ in the reduplicated syllable ( अभ्यास ), by P. VII. 4.79. This सन्वद्भाव is prescribed in the case of a root ending in इ ( णिच् ) before the aorist sign ( विकरण ) चङ्. confer, compare सन्वल्लघुनि चङ्परेनग्लोपे VII. 4.93.
sārvadhātukaa term used in Panini's grammar for affixes applied to verbs, such as the personal endings and those krt affixes which are marked with.the mute letter श्; confer, compare तिङ् शित्सार्वधातुकम् P. III. 4. 113. The term was taken into his grammar by Panini from ancient grammar works and thence in their grammars by other grammarians; confer, compare सार्वधातुकमिति पूर्वाचार्यप्रसिद्धा संज्ञेयं निरन्वया, स्वभावान्नपुंसकलिङ्गमिति। Trilok-commentary on Kat. III. 1.34, The term सार्वधातुका also was used by ancient grammarians before Panini; confer, compare अापिशलास्तुरुस्तुशम्यमः सर्वधातुकासु च्छन्दसीति पठन्ति. Kāśikā of Jayāditya and Vāmana. on P. VII. 3.95.
sthānivadbhāvabehaviour of the substitute like the original in respect of holding the qualities of the original and causing grammatical operations by virtue of those qualities. By means of स्थानिवद्भाव,the substitute for a root is,for instance, looked upon as a root; similarly, a noun-base or an affix or so, is looked upon like the original and it can cause such operations or be a recipient of such operations as are due to its being a root or a noun or an affix or the like. This स्यानिवद्भाव cannot be, and is not made also, a universally applicable feature; and there are limitations or restrictions put upon it, the chief of them being अल्विधौ or in the matter of such operations as are caused by the 'property of being a single letter' (अल्विधौ). There are two views regarding this 'behaviour like the original' : (l) supposed behaviour which is only instrumental in causing operations or undergoing them which is called शास्त्रातिदेदा and (2) actual restoration to the form of the original under certain conditions only as prescribed which is called रूपातिदेश. The रूपातिदेश is actually resorted to by some grammarians in the case of the reduplication of roots; confer, compare Kāśikā of Jayāditya and Vāmana. on द्विवेचनेचि P.I.1.59 and M.Bh. on P.I.1.59.See the word रूपातिदेश also. For details see Vol. VII p.p. 241243, Vyākarana Mahabhasya D.E. Society's Edition.
aglopaelision of the vowel a, i,u , r or l ( अ, इ, उ, ऋ or लृ ) which prevents Sanvadbhāva confer, compare सन्वल्लघुनि चङ्परेSनग्लोपे P. VII.4.93, as also नाग्लोपिशास्वृदिताम् VII.4.2 where the elision prevents the shortening of the penultimate vowel if it is long.
aṭ(1)token term standing for vowels and semi-vowels excepting l ( ल्) specially mentioned as not interfering with the substitution of ṇ ( ण् ) for n ( न् ) exempli gratia, for example गिरिणा, आर्येण, खर्वेण et cetera, and others Sec P.VIII.4.2; (2) augment a (अट्) with an acute accent, which is prefixed to verbal forms in the imperfect and the aorist tenses and the conditional mood. exempli gratia, for example अभवत्, अभूत्, अभविष्यत् Sec P.IV.4.71; (3) augment a ( अट् ) prescribed in the case of the roots रुद्, स्वप् et cetera, and others before a Sārvadhātuka affix beginning with any consonant except y ( य्), exempli gratia, for example अरोदत्, अस्वपत्, अजक्षत्, आदत् et cetera, and others; see P.VII.3, 99, 100;(4) augment a ( अट् ) prefixed sometimes in Vedic Literature to affixes of the Vedic subjunctive (लेट्) exempli gratia, for example तारिवत्, मन्दिवत् et cetera, and others see P.III.4.94.
atādrūpyātideśaconveyance of only the properties of one to another without conveying the actual form, described as the significance of antādivadbhāva. confer, compare न वा अताद्रूप्यातिदेशात् Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. VI.1.85 Vārttika (on the Sūtra of Pāṇini). 26. See ताद्रूप्यातिदेश below.
atideśaextended application; transfer or conveyance or application of the character or qualities or attributes of one thing to another. Atideśa in Sanskrit grammar is a very common feature prescribed by Pāṇini generally by affixing the taddhita affix. affix मत् or वत् to the word whose attributes are conveyed to another. e. g. लोटो लङ्वत् P. III. 4.85. In some cases the atideśa is noticed even without the affix मत् or वत्; exempli gratia, for exampleगाङ्कुटादिभ्योऽञ्णिन् ङित् P. 1.2.1 . Atideśa is generally seen in all grammatical terms which end with 'vadbhāva' e. g. स्थानिवद्भाव (P.I.1.56-59), सन्वद्भाव (P.VII.4.93), अन्तादिवद्भाव (P. VI.1.85), अभूततद्भाव (P.IV.60) and others. Out of these atideśas, the स्थानिवद्भाव is the most important one, by virtue of which sometimes there is a full representation id est, that is substitution of the original form called sthānin in the place of the secondary form called ādeśa. This full representation is called रूपातिदेश as different from the usual one which is called कार्यातिदेश, confer, compare Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). VIII.1.90 Vārttika (on the Sūtra of Pāṇini). 1 and VIII.1.95. Vart.3. Regarding the use of अतिदेश there is laid down a general dictum सामान्यातिदेशे विशेषानतिदेशः when an operation depending on the general properties of a thing could be taken by extended application, an operation depending on special properties should not be taken by virtue of the same : e. g. भूतवत् in P. III.3.132 means as in the case of the general past tense and not in the case of any special past tense like the imperfect ( अनद्यतन ) , or the perfect ( परोक्ष ). See Paribhāṣenduśekhara of Nāgeśa. Pari. 101, Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. III. 3. 132. There is also a general dictum अतिदेशिकमनित्यम्whatever is transferred by an extended application, need not, be necessarily taken. See Paribhāṣenduśekhara of Nāgeśa. 93.6 as also Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P.I.1.123 Vārttika (on the Sūtra of Pāṇini).4, I.2.1 Vārttika (on the Sūtra of Pāṇini). 3, II.3.69 Vārttika (on the Sūtra of Pāṇini).2 et cetera, and others, Kaiyaṭa on II. 1.2 and VI.4.22 and Kāśikāvivaraṇapañjikā, a commentary on the Kāśikāvṛtti by Jinendrabuddhi, called Nyāsa. on P. I.1.56 and P. I.2.58 Vārttika (on the Sūtra of Pāṇini). 8. The dictum अातिदेशिकमनित्यम् is given as a Paribhāṣā by Nāgeśa confer, compare Pari. Śek. 93. 6.
apitnot marked with the mute letter प्, A Sārvadhātuka affix not marked with mute प् is looked upon as marked with ड् and hence it prevents the guṇa or vṛddhi substitution for the preceding vowel or for the penultimate vowel if it be अ. e. g. कुरुतः तनुतः, कुर्वन्ति where no guṇa takes place for the vowel उ confer, compare सार्वधातुकमपित्. P.I.2.4.
ādyantavattvaअाद्यन्तवद्भाव, consideration of a single or solitary letter as the initial or the final one according to requirements for opcrations prescribed for the initial or for the final. Both these notions --the initial and the final-are relative notions, and because they require the presence of an additional letter or letters for the sake of being called initial or final it becomes necessary to prescribe आद्यन्तवद्भाव in the case of a single letter; confer, compareअाद्यन्तवदेकस्मिन् । आदौ इव अन्त इव एकस्मिन्नपि कार्यं भवति । यथा कर्तव्यमित्यत्र प्रत्ययाद्युदात्तत्वं भवति एवमौपगवमित्यत्रापि यथा स्यात् । Kāś. on P.I.1.21 ; confer, compare also अाद्यन्तवच्च । अपृक्तस्य आदिवदन्तवच्च कार्यं भवति । Taittirīya Prātiśākhya.I.55. This अाद्यन्तवद्भाव of Pāṇini is, in fact, a specific application of the general maxim known as vyapadeśivadbhāva by virtue of which "an operation which affects something on account of some special designation, which for certain reasons attaches to the letter, affects likewise that which stands alone;" confer, compare Pari.Śek. Pari. 30.
ārdhadhātukaa term used in contrast to the term सार्वधातुक for such verbal and kṛt affixes, as are not personal endings of verbs nor marked with the mute letter श् confer, compare तिङ्शित् सार्वधातुकम् । आर्धधातुकं शेषः। P.III.4.113 and 114. The personal endings of verbs in the perfect tense and the benedictive mood are termed ārdhadhātuka, confer, compare P. III. 4.115, 116; while both the terms are promiscuously found utilised in the Vedic Literature; confer, compare P. III. 4. 117. The main utility of the ārdhadhātuka term is the augment इ ( इट् ) to be prefixed to the ārdhadhātuka affixes. The term आर्धधातुका was in use in works of the old Vaiyākaraṇas; confer, compare अथवा आर्धधातुकासु इति वक्ष्यामि कासु आर्धधातुकासु । उक्तिषु युक्तिषु रूढिषु प्रतीतिषु श्रुतिषु संज्ञासु M.Bh. on II. 4.35. It cannot be said how the term ārdhadhātuka originatedition Probably such affixes or pratyayas, like the kṛt affixes generally, as could be placed after certain roots only were called ārdhadhātuka, as contrasted with the verbal and the present participle affixes which were termed sārvadhātuka on account of their being found in use after every root.
īṭaugment ई prefixed to a Sārvadhātuka (strong) affix beginning with a consonant after the roots ब्रू, रु, स्तु, and others exempli gratia, for example अब्रवीत्, रोरवीति, स्तवीति, अकार्षीत्, अवादीत् et cetera, and others; confer, compare P. VII. 3.93-98.
u(1)labial vowel standing for the long ऊ and protracted ऊ3 in Pāṇini's grammar unless the consonant त् is affixed to it, उत् standing for the short उ only: (2) Vikaraṇa affix उ of the 8th conjugation ( तनादिगण ) and the roots धिन्व् and कृण्व्;confer, compareP.III. 1.79-80; (3) substitute (उ) for the vowel अ of कृ,exempli gratia, for example कुरुतः, कृर्वन्ति before weak Sārvadhātuka affixes, confer, compareP.VI 4.110; (4) kṛt (affix). affix उ added to bases ending in सन् and the roots आशंस्, भिक्ष्, विद्, इष् as also to bases ending in क्यच् in the Vedic Literature,exempli gratia, for example चिकीर्षुः भिक्षुः, बिन्दुः,इच्छुः,सुम्नयु; confer, compare P. III. 2.168-170; (5) Uṅādi affix उ ( उण् ) e.g, कारुः, वायुः, साधुः, et cetera, and others; confer, compare Uṅādi I.1; (6) mute vowel उ added to the first letters of a class of consonants in Pāṇini's grammar to show the whole class of the five letters; exempli gratia, for example कु, चु, टु, तु, पु which stand for the Guttural, the palatal the lingual, the dental and the labial classes respectively; confer, compare also ष्टुना ष्टुः P.VIII.4.41(7) उ added to न् showing the consonant न् as nasalized n; cf, नुः V.Pr. III.133.
utsūtranot consistent with what is taught in rules of a Śāstra; confer, compare अनुत्सूत्रपदन्यासा सद्वृत्तिः सन्निबन्धना । शब्दविद्येव नो भाति राजनीतिरपस्पशा Śiśupālavadha II.
ubhayathāin both the ways (in the case of an option, of course); confer, compare छन्दस्युभयथा P.III.4.117 where the word ubhayathā refers to both the alternative uses exempli gratia, for example Sārvadhātuka and Ārdhadhātuka;so also vidhiliṅ and āśīrliṅ; confer, compare Kāśikā on P.III.4.117. The term ubhayatha is described as synonymous with 'bahulam' or 'anyatarasyām' or 'vā' or ekeśām'; confer, compare बहुलमन्यतरस्यामुभयथा वा एकेषामिति Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P.I. 1.44: Vart. 19; confer, compare also अध्यायान्तेषूभयथा स्मरन्ति R.Pr.XV.8.
kārakapādaname given by Śivadeva and other grammarians to the fourth pāda of the first adhyāya of Pāṇini's Pāṇini's Aṣṭādhyāyī. which begins with the Sūtra कारके I. 4. 1 and which deals with the Kārakas or auxiliaries of action.
kṛṣṇamitraa scholar of grammar and nyāya of the 17th century A.D. who wrote many commentary works some of which are (l) a commentary called Ratnārṇava on the Siddhānta-Kaumudī, (2) a commentary named Kalpalata on Bhaṭṭoji's Prauḍhamanoramā, (3) a commentary named Bhāvadīpa on Bhaṭṭoji's Śabdakaustubha of Bhaṭṭojī Dīkṣita., (4) a commentary on Nagojibhaṭṭa's Laghumañjūṣā of Nāgeśa.by name Kuñcikā and (5) a commentary on Vaiyākaraṇabhūṣaṇa.
khaśkṛt affix added to the roots यज् (causal), ध्मा, धे,रुज्, वह्, लिह्, पच् , दृश् , तप्, मन् et cetera, and others preceded by certain specified upapada words. The root undergoes all the operations such as the addition of the conjugational sign et cetera, and others before this खश् on account of the mute letter श् which makes खश् a Sārvadhātuka affix, and the augment म् is added to the preceding उपपद if it is not an indeclinable on account of the mute letter ख्; e. g. जनमेजयः, स्तनंधयः, नाडिंधमः, असूयै. पश्यः पण्डितंमन्यः etc,; confer, compare Pāṇ. III2.28-37, 83.
gotrinda( चक्रवर्तिन् )writer of Samasavada, a short treatise on the sense conveyed by compound words.
ca(l)the letter च्, the vowel अ being added for facility of utterance, cf Taittirīya Prātiśākhya.I. 21; (2) a Bratyahara or short term standing for the palatal class of consonants च्, छ्, ज्,झ् and ञ्; cf इचशेयास्तालौ Vājasaneyi Prātiśākhya.I. 66; (3) indeclinable च called Nipata by Panini; confer, compare चादयोSसत्त्वे P. I. 4.57, च possesses four senses समुच्चय, अन्वाचय, इतरेतरयोग and समाहार confer, compare Kāśikā of Jayāditya and Vāmana. on II. 2.29. See also Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on II. 2.29 Vart. 15 for a detailed explanation of the four senses. The indeclinable च is sometimes used in the sense of 'a determined mention' or avadharana; confer, compare Kāśikā of Jayāditya and Vāmana. on II. 1.48 and 72. It is also used for the purpose of अनुवृत्ति or अनुकर्षण i. e. drawing a word from the previous rule to the next rule; (confer, compare Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. VI. 1.90) with a convention that a word drawn thus, does not proceed to the next rule; confer, compare चानुकृष्टं नोत्तरत्र Par. Sek Pari. 78; (4) a conventional term for अभ्यास (reduplicative syllable) used in the Jainendra Vyakarana; confer, compare चविकारेषु अपवादा उत्सर्गान्न बाधन्ते Kat. Pari. 75.
tādrūpyarestoration to, or resumption of the same form by the rule of Sthanivadbhava, prescribed in P.I. 1.56, called रूपातिदेश as contrasted with कार्यातिदेश; confer, compare नेह ताद्रूप्यमतिदिश्यते Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on VI. 1.85 Vart. 26.
durdhaṭoddhāraname.of a commentary by Kesavadatta-Sarman on the grammar work named संक्षिप्तसार.
paspaśācalled also पस्पशाह्निक; name given to the first or introductory chapter ( अाह्निक ) of the Maahabhaasya of Patanjali. The word occurs first in the SiSupaalavadha of Maagha. The word is derived from पस्पश् , the frequentative base of स्पर्श to touch or to see (ancient use). Possibly it may be explained as derived from स्पश् with अप; cf . शब्दबिद्येव नो भाति राजनीतिरपस्पशा Sis.II.112. Mallinatha has understood the word पस्पश m. and explained it as introduction to a Saastra treatise; confer, compare पस्पशः शास्त्रारम्भसमर्थक उपेद्वातसंदर्भग्रन्थः । Mallinaatha on SiS. II.112.
pitmarked with the mute letter प् which is indicative of a grave accent in the case of affixes marked with it, as for example, the affixes तिप् , सिप् and मिप् ; confer, compare अनुदात्तौ सुप्पितौ P. III. 1.4. A Sarvadhātuka affix, marked with the mute consonant प्, in Pāņiņi's Grammar has been described as instrumental in causing many operations such as (a) the substitution of guņa; (cf P. VII. 3 84,9l). (b) the prevention of guņa in the case of a reduplicative syllable as also in the case of the roots भू and सू ( confer, compare P. VII. 3.87, 88 ); (c) the substitution of Vŗddhi, (confer, compare P. VII. 3.89, 90 ), (d) the augments इ and ई in the case of the roots तृह् and ब्रू respectively ( confer, compare P. VII. 3.92, 93, 94 ), and (e) acute accent for the vowel preceding the affix in the case of the roots भी, हृी, भृ and others ( confer, compare P. VI. 1.192 ). A short vowel (of a root) gets त् added to it when followed by a kŗt affix marked with प्: exempli gratia, for example, विजित्य​, प्रकृत्य, et cetera, and others:(confer, compare P. VI. 1.71 ).
prauḍhamanoramāpopularly called मनोरमा also; the famous commentary on the Siddhantakaumudi of Bhattoji Diksita written by the author himself to explain fully in a scholarly manner the popular grammar written by him; , the word प्रौढमनेारमा is used in contrast with बालमनोरमा another commentary on the Siddhantakaumudi by Vasudevadiksita. On account of the difficult nature of it, it is usual to read the प्रौढमनेारमा upto the end of the Karaka-prakarana only in the Sanskrit PathaSalas before the study of the Sabdendusekhara and the Paribhsendusekhara is undertaken.
y(1)the consonant य् with अ added to it merely for the sake of facility in pronunciation; यकार is also used in the same sense: e. g. लिटि वयो यः: P.VI.1.38 confer, compare T.Pr.I: 17,21;(2) krt affix (यत्) prescribed as कृत्य or potential passive participle; exempli gratia, for exampleचेयम्, गेयम्, शाप्यम् , शक्यम् , गद्यम् , अजर्यम् पण्यम् et cetera, and others: confer, compare अचो यत्...अजर्यं संगतम् P.III. 1.97-105; (3) krt. affix क्यप् which is also an affix called krtya; e. gब्रह्मोद्यम् , भाव्यम्, घात्यम् , स्तुत्यम् , कल्प्यम् , खेयम् , भृत्यः:, भिद्यः, पुष्य:, कृत्यम्,also कार्यम् ; confer, compare P. III. 1.106-128:(4) krt affix ण्यत् ( which is also कृत्य ), e. g कार्यम् , हार्यम् , वाक्यम् , लाव्यम्, कुण्डपाय्यम्. et cetera, and others: cf P. III. 1.124-132: (5) taddhita affix. affix य affixed (a) in the sense of collection to पाश, वात et cetera, and others, as also to खल, गो and रथ, e. g. पाद्या, रथ्या et cetera, and others confer, compare P. IV. 2. 49, 50ः (b) in the चातुरर्थिक senses to बल, कुल, तुल et cetera, and others e. g. वल्यः,.कुल्यम् efeminine. P V.2. 80, (c) as a Saisika taddhita affix. affix to ग्राम्यहः' along with the affix खञ्ज e. g. ग्राम्यः, ग्रामीणः: cf P: IV. 2.94 (d) in the sense of 'good therein' ( तत्र साधुः ) and other stated senses affixed to सभा, सोदर पूर्व, and सोम: e. g. सभ्य:, पूर्व्यः; .et cetera, and others. confer, compare P. IV. 4.105, 109, 133, 137, 138: (e) in the sense of 'deserving it' to दण्ड and other words, e. g. दण्ड्य, अर्ध्र्य, मध्य, मेध्य, et cetera, and others: cf P. V. 1.66: ( f ) in the sense of quality or action to सखि e. g. सख्यम् ; cf P. V. 1.126: (6) taddhita affix. affix यत् applied to (a) राजन् श्वशुर, कुल, मनु in the sense of offspring, (b) शूल्, उखा, वायु, ऋतु and others, under certain conditions; confer, compare P. IV. 2.17, 31, 32, 101, (c) to अर्ध, परार्ध, words in the class headed by दि्श, छन्दस and others in specific senses; cf P. IV. 3-46, 54 et cetera, and others and (d) in specific senses to specific words mentioned here and there in a number of sUtras from IV.4, 75 to V.4.25; (e) to शाखा, मुख, जघन and others in the sense of इव (similar to) exempli gratia, for example शाख्यः, मुख्य:, et cetera, and others: confer, compare P. V. 3. 103; (7) case-ending य substituted for ङे of the dative sing; e. g. रामाय confer, compare P. VII. 3.102: (8) verb-affix यक् applied to the nouns कण्डू and others to make them ( denominative ) roots; e. g. कण्डूय,सन्तूय et cetera, and others confer, compare कण्ड्वादिभ्यो यक् P. III. 1.27 (9) | Vikarana य ( यक् ) applied to any root before the Saarvadhaatuka personal endings to form the base for the passive voice as also the base for the 'Karmakartari' voice e g क्रियते, भूयते, confer, compare सार्वधातुके यक् P. III. 1.67 (10) Unaadi affix य ( यक् ) applied to the root हृन् to form the Vedic word अघ्न्य: cf अघ्न्यादयश्च: ( 11 ) augment य ( यक् ) added to the affix क्त्वा in Vedic Literature: e. g. दत्त्वायः confer, compare क्त्वो यक् P. VII.1.47; (12) verb affix यङ् added to a root to form its Intensive base ( which sometimes is dropped ) and the root is doubledition e. g. चेक्रीयते,चर्करीति;. confer, compare P. III. 1.22,24; (13) short term ( प्रत्याहृार ) supposed to be beginning with य in the affix यइ in the sUtra धातेरेकाचो ... यङ् III. 1.22, and ending with ङ् in the sUtra लिड्याशिष्यङ्क III. 1.86, with a view to include the various verb affixes and conjugational signs.
riṅsubstitute रि for a verbal base ending in ऋ before श (the sign of the 6th conjugation) यक् (sign of the passive voice. voice) and a लिङ् affix beginning with य which is not a Sārvadhātuka affix; e. g. अाद्रियते, क्रियते, क्रियात्; confer, compare रिङ् शयग्लिङ्क्षु P.VII.4.28.
rīṅsubstitute री for the vowel ऋ at the end of a base ( अङ्ग ) before the affix च्चि as also before य which does not belong to a krt or Sarvadhatuka affix; exempli gratia, for example मात्रीभूतः, मात्रीयते; confer, compare रीङ् ऋतः P.VII.4.27.
rudādia term used for the five roots headed by the root रुद्,which have the augment इ added to a Sārvadhātuka affix in certain cases; exempli gratia, for example रोदिति, श्वसिति, अरोदीत्, अस्वपीत् et cetera, and others; confer, compare P.VII. 2. 76, VII.3.98.
luptathat which has been elided or dropped during the process of the formation of words. As elision or लोप is looked upon as a kind of substitutē, in short a zerosubstitutē, the convention of the substitute being looked upon as the original one, viz.the sthānivadbhāva, applies to it.
vāḍavapossibly the same as Kunaravadava; an ancient grammarian quoted in the Mahabhasya; confer, compare तत्र सौर्थभगवतोक्तमनिष्टिज्ञो वाडव: पठति, Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). on P. VIII. 2. 106 Vव्रrt 3.
vāsudeva dīkṣitason of महादेव दीक्षित, the author of the Balamanorarma, a commentary on the Siddhantakaumudi. Vasudevadiksita was a resident of Tanjore who lived in the beginning of the eighteenth century A.D. and wrote a few works on Purvamimamsa.
vighnakṛtimpediment to an operation caused by something preceding on account of its coming in the way: a vyavaya or vyavadhana or intervention which is not admissible just as the interruption of palatals, linguals, dentals and sibilants excepting हू for the change of न् into ण् : confer, compare अव्यवेतं विग्रहे विघ्नकृद्भिः R.Pr. V.25.
vyākaraṇadarśanathe science of Vyakarana with the element of Sphota introduced in it and brought consequently on a par with the other Darsanas by the stalwart grammar-scholar Bhartrhari of the 7th century A. D. For details see Sarvadarsanasangraha ' Paninidarsanam ' and page 385 Vol. VII. of the Vyakarana Mahabhasya edited by the D. ESociety, Poona.
śā(1)conjugational sign(विकरण) applied to the roots of the sixth conjugation ( तुदादिगण ) in all conjugational tenses and moods ( i, e. the present, the imperfect,the imperative and the potential ) before the personal-endings; confer, compare तुदादिभ्यः शः, P. III.1.77; this sign श ( अ ) has got the initial consonant श्， as an indicatory one, and hence this अ is a Sarvadhatuka affix, but, it is weak and does not cause गुण for the preceding vowel; ( 2 ) taddhita affix. affix श in the sense of possession applied to the words लोमन् and others; e. g. लोमश:, रोमशःconfer, compare P.V.2. 100; (3) krt affix (अ ) applied to the roots पा, घ्रा, ध्मा, धे and दृश् when preceded by a prefix,to the roots लिम्प्, विन्द् et cetera, and othersnot preceded by a prefix, and optionaily to दा and धा of the third conjugation in the sense of an agent'; exempli gratia, for example उत्पिबः, उत्पश्यः, लिम्प:, विन्दः दद:, दायः: confer, compare P.III.1.137-139.
śatṛkrt affix अत् in the sense of ' the agent of the present time ', applied to any root which takes the Parasmaipada personal affixes confer, compare लट: शतृशानचावप्रथमासमानाधिकरणे P. III. 2.126,8. The words formed with this शतृ (अत्) affix are termed present participles in the declension of which, by virtue of the indicatory vowel ऋ in शतृ, the augment नुम् is inserted after the last vowel of the base, and the root receives such modifications as are caused by a Sarvadhatuka affix, the affix शतृ being looked upon as a Sarvadhatuka affix on account of the indicatory letter श्. The word ending in this affix शतृ governs a noun forming its object, in the accusative case.
śapa vikarana affix ( conjugational sign ) applied to roots of the first conjugation and in general to all secondary roots i. e. roots formed from nouns and from other roots before personal-endings which are Sarvadhatuka and which possess the sense of agent, provided there is no other vikarana affix prescribed: e. g. भवति, एधते, कारयति, हारयति, बुभूपति, पुत्रीयति, पुत्रकाम्यति, कामयते, गेीपांयति, कण्ङ्कयति, पटयति, दिनन्ति (यामिन्य:) et cetera, and others confer, compare कर्तरि शप् , P. III.1 .68. This affix शप् is dropped after roots of the second conjugation (अदादि } and those of the third conjugation ( जुहोत्यादि) and in Vedic Literature wherever observed; confer, compare P.II.4.72, 73, 75, 76.
śitpossessed of, or characterized by, the indicatory letter श्; the krt affixes which are marked with the indicatory श् are termed Sarvadhatuka affixes (confer, compare P.III.4.113), while, the Adesas or substitutes, marked with the indicatory श्, are substituted for the whole of the Sthanin or the original and not for its final letter according to the rule अलोन्त्यस्य P. I.1.52; e. g. शि is substituted,not for the final स् of जस् and शस् but for the whole जस् and the whole शस्; confer, compare P.I.1.55.
śnāa vikarana or conjugational sign of the ninth conjugation, to be added to roots headed by क्री before the Sarvadhatuka affixes; exempli gratia, for example क्रीणाति; confer, compare क्र्यादिभ्य: श्ना. P.III.1.81. श्ना is added optionally with श्नुः ( नु ) to the roots स्तम्भ्, स्तुम्भ्, स्कम्भ् , स्कुम्भ् and स्कु. exempli gratia, for exampleस्तभ्नाति, स्तभ्नोति, स्कुभ्नाति, स्कुभ्नोति etc : confer, compare P.III.1.82.
śyana vikarana or conjugational sign of the fourth conjugation added to roots headed by दिव्, before the Sarvadhatuka affixes; exempli gratia, for example. दीव्यति, पुष्यति, et cetera, and others श्यन् is added optionally with शप् (अ) to the roots भ्राश्, भ्रम् , क्लम् and others, as also to यस्.
sāmānyaviśeṣabhāvathe relationship between the general and the particular, which forms the basis of the type of apavada which is explained by the analogy of तक्रकौण्डिन्यन्याय; the word also refers to the method followed by the Sutras of Panini, or any treatise of grammar for the matter of that, where a general rule is prescribed and, for the sake of definiteness some specific rules laying down exceptions, are given afterwards: confer, compare किंचित्सामान्यविशेषवल्लक्षणं प्रवर्त्यं येनाल्पेन यत्नेन महतः शद्बौघान् प्रतिपद्येरन् l Mahābhāṣya of Patañjali on the Sūtras of Pāṇini (Dr. Kielhorn's edition ). Ahnik 1.
Vedabase Search
1119 results
vada kindly describeSB 3.7.27
vada kindly explainSB 9.1.5
vada kindly instructSB 7.9.17
vada kindly saySB 10.1.3
vada kindly speakSB 10.7.1-2
vada kindly tellSB 7.13.18
vada kindly tell usSB 8.9.3
vada please describeSB 2.5.2
SB 8.1.2
vada please explainSB 10.13.39
vada please speakSB 1.4.2
SB 11.22.60
SB 12.8.1
SB 4.21.10
vada please tellBG 3.2
SB 10.90.21
SB 11.23.46
vada saySB 3.4.18
SB 9.14.12
vada speakSB 4.24.16
vada tellSB 3.21.4
vadāmi I am speakingSB 4.24.31
vadāmi I sayCC Adi 4.211
vadāmi I shall explainSB 10.13.3
SB 9.22.43
vadāmi I speakMM 27
vadāmi I will now speakSB 11.11.5
vadāmi kim can I saySB 7.10.70
vadāmi kim can I saySB 7.10.70
vadan sayingCC Madhya 22.101
vadana and faceSB 5.25.5
vadana by His faceSB 10.61.3
vadana by his faceSB 4.16.9
vadana by His faceSB 5.5.31
vadana countenanceSB 3.28.13
SB 3.28.29
vadana faceCC Madhya 2.29
SB 1.11.19
SB 3.15.44
SB 5.5.31
vadana facesCC Madhya 21.67
SB 7.9.36
vadanā having a faceSB 5.9.18
vadana His faceSB 10.43.15
vadana mouthCC Antya 12.5
SB 4.8.45
vadanā my faceSB 10.83.28
vadana on the mouthCC Adi 17.15
CC Madhya 1.84
vadana the faceCC Antya 19.94
CC Madhya 8.270
SB 10.44.11
SB 10.45.17-18
vadana the mouth of whichSB 12.6.70
vadana whose faceSB 6.4.35-39
vadana-aravinda-śriyā with His beautiful lotuslike faceSB 5.18.16
vadana-aravinda-śriyā with His beautiful lotuslike faceSB 5.18.16
vadana-aravinda-śriyā with His beautiful lotuslike faceSB 5.18.16
vadana-kamala the lotuslike faceCC Madhya 12.211
vadana-kamala the lotuslike faceCC Madhya 12.211
vadana-pańkajam whose lotus faceSB 12.9.22-25
vadana-pańkajam whose lotus faceSB 12.9.22-25
vadana-vidhu of His moonlike faceCC Antya 19.76
vadana-vidhu of His moonlike faceCC Antya 19.76
vadanāḥ facesSB 10.73.1-6
vadanaḥ His faceSB 10.35.24-25
SB 4.30.6
vadanaḥ whose faceSB 10.75.39
vadanāḥ whose facesSB 10.75.16
SB 10.90.10
vadanaiḥ by the mouthsBG 11.30
vadanaiḥ facesSB 12.6.44
vadanam faceCC Madhya 21.136
CC Madhya 23.35
SB 1.11.10
SB 10.73.1-6
vadanām faceSB 8.9.18
vadanam mouthCC Antya 20.36
SB 2.1.28
vadanam the faceSB 1.7.52
vadanam whose faceSB 10.39.46-48
SB 10.51.23-26
SB 10.53.29
SB 10.54.10
vadanāni the facesSB 10.33.20
vadane faceCC Antya 17.59
vadane in the mouthCC Madhya 16.72
SB 2.7.30
SB 8.20.25-29
vadane in the mouthsCC Madhya 8.42
vadane mouthsCC Adi 8.53
vadanena with facesSB 4.1.25
vadanena with her faceSB 10.80.8
vadantaḥ sayingSB 7.7.3
vadantaḥ speakingSB 10.6.41
vadanti (expert astrologers) saySB 11.23.53
vadanti (the Vedas) saySB 10.87.20
vadanti all learned men saySB 8.5.43
vadanti are lodging this complaintSB 10.8.34
vadanti do saySB 3.4.13
SB 3.8.15
vadanti do they saySB 3.1.10
vadanti explainSB 4.11.22
vadanti people callSB 10.51.39-40
vadanti propoundSB 11.14.10
vadanti sayBG 8.11
SB 10.77.30
SB 5.12.11
SB 8.6.12
vadanti speakSB 11.21.26
SB 11.3.32
SB 11.5.8
vadanti the great learned sages saySB 5.16.28
vadanti the learned Vedic scholars concludeSB 10.3.19
vadanti they callSB 9.24.27
vadanti they sayCC Adi 2.11
CC Adi 2.63
CC Madhya 20.158
CC Madhya 24.74
CC Madhya 24.81
CC Madhya 25.132
SB 1.2.11
SB 10.43.29
SB 10.68.45
SB 11.15.33
SB 11.27.2
SB 11.30.36
SB 2.4.21
SB 2.5.12
SB 3.31.39
SB 4.25.40
SB 5.11.7
SB 5.11.9
SB 5.24.3
vadanti they say authoritativelySB 5.18.4
vadanti they speakNBS 83
SB 11.14.1
SB 11.14.9
SB 11.5.6
SB 3.25.35
vadanti they suggest (in regard to one's means of livelihood)SB 7.14.6
vadanti sma they spokeSB 10.53.39
vadanti sma they spokeSB 10.53.39
vadantīnām as they were speakingSB 10.46.49
vadantu may speakSB 10.61.32
vadānya magnanimousCC Adi 8.55
CC Madhya 21.121
CC Madhya 22.78-80
CC Madhya 22.95
CC Madhya 25.268
vadānya vastly learnedSB 10.64.14-15
vadānya very magnanimousCC Madhya 16.218
vadānyaḥ magnanimousCC Madhya 23.73
SB 10.62.2
vadānyaḥ munificentSB 3.1.27
vadānyam magnanimousSB 4.25.41
vadānyānām charitableSB 11.1.8
vadānyānām for the generousSB 10.72.19
vadānyānām generousSB 10.64.37-38
vadānyasya who was generousSB 10.64.25
vadānyāt who are so munificentSB 8.19.17
vadānyatā magnanimityCC Adi 7.1
CC Madhya 24.42
vadasi you are speakingSB 10.4.26
SB 5.11.1
vadasi You tellBG 10.14
vadasva kindly describeSB 10.1.4
SB 3.10.2
SB 8.1.1
SB 8.14.1
SB 8.5.11-12
vadasva please describeSB 3.7.23
vadasva please speakSB 11.16.3
vadasva please tellSB 11.1.9
vadata please tellSB 11.3.41
vadatā speakingSB 8.24.25
vadataḥ as I am speakingSB 11.9.24
vadataḥ because of your orderSB 8.23.17
vadataḥ being spokenSB 4.2.33
vadataḥ those who are speakingSB 11.11.16
vadataḥ while speakingSB 3.13.1
vadataḥ wordsSB 4.2.27
vadatām contendingCC Madhya 6.108
vadatām of all speakersSB 11.22.60
vadatām of speakersSB 10.29.17
SB 12.8.1
vadatām of the speculatorsCC Madhya 6.109
vadatām of those arguingSB 11.22.6
vadatām of those who can speakSB 1.4.2
vadatām of those who speakSB 11.22.4
vadatām speaking different philosophiesSB 6.4.31
vadati saysSB 7.5.28
vadati speakSB 10.49.26
vadati speaksSB 10.61.33
SB 5.26.28
vadati speaks ofBG 2.29
vadati were talkingSB 4.4.31
vadbhyaḥ who possessedSB 10.64.14-15
vadet he should speakSB 11.18.16
SB 11.18.29
vadet may kindly enlightenSB 3.5.2
vadet must speakSB 6.18.47
vadha being killedSB 10.54.39
vadha by the deathSB 4.11.9
vadha by the killingSB 10.59.11
SB 10.83.9
vadha for killingSB 10.72.41
vadha for the killingSB 10.78.33
vadha from the killingSB 6.13.5
vadha killingCC Adi 17.157
CC Adi 17.162
vadha to killSB 10.54.32
vadha to murderSB 10.39.8
vadha to slaySB 10.66.29
vadha kari' killingCC Antya 3.160
vadha kari' killingCC Antya 3.160
vadha-arhaṇaḥ is due to be killedSB 1.7.53-54
vadha-arhaṇaḥ is due to be killedSB 1.7.53-54
vadha-bhāgī responsible for killingCC Antya 16.133
vadha-bhāgī responsible for killingCC Antya 16.133
vadha-mātra killing onlyCC Adi 17.165
vadha-mātra killing onlyCC Adi 17.165
vadha-udyamam the endeavor to killSB 10.1.64
vadha-udyamam the endeavor to killSB 10.1.64
vadha-upāyāḥ many varieties of means to kill himSB 7.5.45
vadha-upāyāḥ many varieties of means to kill himSB 7.5.45
vadha-upāyaḥ means of disappearanceSB 3.3.15
vadha-upāyaḥ means of disappearanceSB 3.3.15
vadhaḥ annihilationSB 7.1.25
vadhaḥ deathSB 10.54.37
vadhaḥ killingSB 1.7.51
SB 1.7.57
SB 1.8.50
SB 4.17.26
SB 4.19.27
SB 7.10.42
SB 7.2.20
vadhaḥ murderSB 10.31.2
vadhaḥ the annihilationSB 12.12.37
vadhaḥ the deathSB 12.12.40-41
SB 7.8.23
vadhaḥ the killingSB 10.78.31-32
SB 12.12.28-29
SB 12.12.31-33
SB 12.12.35
SB 4.11.8
SB 8.21.13
SB 9.15.41
SB 9.9.28
vadhaḥ ayam the killingSB 10.2.21
vadhaḥ ayam the killingSB 10.2.21
vadhaḥ ca and killingSB 7.9.29
vadhaḥ ca and killingSB 7.9.29
vadham annihilationSB 3.4.23
SB 8.11.37
vadham being killedSB 10.54.39
vadham deathSB 10.78.24
vadham killingSB 1.8.47
SB 10.60.56
SB 6.18.43
SB 9.9.30
vadham murderSB 12.6.24
vadham the deathSB 11.31.26
vadham the killingSB 10.18.18
SB 10.37.15-20
SB 10.42.26-27
SB 10.57.29
SB 10.57.8
SB 10.71.9
SB 11.1.1
SB 11.16.7
SB 3.14.42
SB 3.14.51
SB 7.10.47
SB 9.9.31
vadham the massacreSB 8.11.29
vadham to be killedSB 1.17.6
vadhān already killedSB 4.6.47
vadhāt by killingSB 4.29.49
vadhāt from killingSB 10.78.28
SB 4.19.15
vadhāt from the act of killingSB 1.9.36
SB 10.1.55
SB 3.1.43
vadhāt from the annihilationSB 7.1.25
vadhāya for killingSB 1.15.13
SB 10.50.9
SB 3.21.50
vadhāya for the killingSB 10.77.35
vadhāya for the purpose of killingSB 1.8.33
vadhe killsCC Madhya 2.19
vadhe of their having been killed by meSB 9.16.7
vadhena by killingSB 10.48.24
vadhena by killing themSB 1.11.34
vadhera of killingCC Adi 17.156
vadhiraḥ hard of hearingSB 1.13.22
vadhiṣyāmi I shall killSB 1.17.10-11
SB 4.17.22
vadhiṣye I shall killSB 10.77.26
vadhū wifeCC Antya 20.12
vadhūḥ a woman (the goddess of fortune, Lakṣmī)SB 4.7.21
vadhūḥ His consortSB 10.30.38
SB 10.47.20
vadhūḥ my daughter-in-lawSB 1.9.13
vadhūḥ my sister-in-lawSB 7.2.20
vadhūḥ the brideSB 10.52.42
SB 10.53.49
vadhūḥ the gopīCC Madhya 19.207-209
vadhūḥ the wifeSB 4.23.25
SB 4.23.29
vadhūḥ wifeSB 4.23.25
vadhūm His consortSB 10.30.31
vadhūm the brideSB 10.53.42-43
vadhūnām of the wivesSB 2.7.33
SB 3.3.5
vadhvāḥ of His special consortSB 10.30.26
vadhvāḥ of the brideSB 10.53.12
vadhvāḥ the brideSB 10.53.27
vadhvaḥ wivesSB 10.47.19
vadhyaḥ anyone is to be killedSB 8.5.22
vadhyaḥ ought to be killedSB 4.19.30
vadhyāḥ to be killedSB 10.78.27
vadhyaḥ who is to be killedSB 7.5.34
vadhyamānāḥ being killed one after anotherSB 7.7.4-5
vadhyān who deserved to be killedSB 9.7.3
vadhyasya of one who is to be killedSB 11.10.20
vadhyatām kill HimSB 10.42.19
vadhyatām let him be killedSB 7.5.34
vadhyatām will be killedSB 1.7.39
vadiṣyanti will sayBG 2.36
vadiṣyanti will they saySB 11.1.18
ā-śarīra-dhāraṇā-avadhi for as long as one still has this bodyNBS 14
punar-ukta-vad-ābhāsa tinge of punar-ukta-vatCC Adi 16.77
abhiṣṭuvadbhiḥ offered prayers to the LordSB 8.7.12
abhivadan requestingCC Antya 16.87
abhivadanti the ṛg Veda mantras praiseSB 5.23.1
adbhuta-vadānya wonderfully magnanimousCC Antya 17.68
adhaḥ-vadanam downward faceSB 1.14.23
pūtanā-vadha-ādi killing of the demons like PūtanāCC Madhya 20.381
pūtanā-vadha-ādi killing the demons, beginning from PūtanāCC Madhya 20.394
adya-avadhi to dateCC Madhya 9.248
tattvadarśa-ādyāḥ and others, like TattvadarśaSB 8.13.31
agha-vadanāt from the mouth of AghāsuraSB 10.13.4
navadvīpa āila came to NavadvīpaCC Antya 2.160
svadhāmā-ākhyaḥ SvadhāmāSB 8.13.29
avadhūta-ākṛtiḥ the dress of a mendicantCC Madhya 24.348
prasanna-vadana-ambhojaḥ Vasudeva, who externally presented himself as if very happySB 10.1.53
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
śrī-vadana-ambujaḥ having a beautiful lotus faceSB 8.18.2
aṃśera avadhāna manifestation of the partCC Adi 5.81
sudhā-aṃśu-vadana whose face is like the moonCC Adi 3.44
avyavadhāna-ananya-bhakti-yogena by uninterrupted and unflinching devotional serviceSB 5.18.7
anavadyā without desire for fruitive resultsSB 1.9.33
anavadya unimpeachableSB 3.14.27
anavadya magnanimousSB 4.21.7
anavadya-lakṣaṇam as bearing the characteristics of a dull animal because of a fat body like a bull's and because of being deaf and dumbSB 5.9.14
anavadya-ańgīm having a perfect bodySB 9.3.36
anavadya unquestionableSB 10.53.3
anavadya faultlessSB 10.53.24
anavadya faultlessSB 10.53.37
anavadya-ātmā a soul free from envy, jealousy, etc.SB 11.11.29-32
anavadyaḥ the unimpeachable LordSB 11.6.8
anavadyām without material contaminationSB 5.25.10
anavadyam faultless (free from contamination)SB 6.16.40
anavadyam the perfectSB 11.7.18
anavadyena without flawSB 3.3.20
anavadya-ańgīm having a perfect bodySB 9.3.36
anuvadan began to repeatSB 4.21.20
anvadhāvat ranSB 3.31.36
anvadhāvat he chasedSB 4.17.15
anvadhāvat began to followSB 9.4.50
anvadhāvat began to follow HimSB 10.9.9
anvadhāvat ranSB 10.34.30
anvadhāvat he pursuedSB 10.51.1-6
anvadhāvat he ran afterSB 10.52.9
anvadhāvat running afterSB 11.5.34
anvadhāvata followedSB 4.19.13
anvadhāvata followedSB 4.28.34
anvadhāvata followedSB 9.15.28
anvadhāvatām ran afterSB 10.34.27
anvadravan followedSB 4.28.23
anvadravat began to chaseSB 4.19.16
anvadravat ran afterSB 10.57.20
anvadṛśyata appeared after thisSB 10.79.2
āpana-vadane personally, with His own mouthCC Madhya 25.267
api avadhāraṇe this api is used for emphasisCC Madhya 24.171
sarva-artha-vadhaḥ killing all beneficial opportunitiesSB 9.9.28
mat-vadha-artham for the purpose of killing meSB 1.9.38
navadvīpe āsi' coming to NavadvīpaCC Antya 12.9
aśru-vadanām with tears on the faceSB 1.16.18
āśru-vadanām with tears in her eyesSB 1.17.3
asura-vadhūnām of the wives of those demonsSB 5.24.15
ātma-avadyam the fault you have committedSB 9.14.12
ātma-vadbhiḥ by those who are self-controlledSB 11.6.10
anavadya-ātmā a soul free from envy, jealousy, etc.SB 11.11.29-32
avadadhyau insultedSB 4.5.9
avadānataḥ pouring an oblation after each lineSB 11.27.38-41
avadat explainedSB 9.4.10
avadat He spokeSB 10.29.17
avadat he spokeSB 10.49.16
avadat saidSB 10.58.23
avadat he toldSB 10.71.20
avadat He spokeSB 11.4.17
avadāta pureSB 5.14.46
avadātāḥ glowingSB 2.9.11
avadātaḥ completely pureSB 5.1.23
avadātaḥ fully pureSB 5.6.14
śyāma-avadātaḥ whose body is blackish and free from inebrietySB 8.18.2
śyāma-avadātam beautiful with black colorSB 3.4.7
avadātam without any tingeSB 9.5.21
avadātam glowing whiteSB 10.16.9
avadātānām who are purifiedSB 7.11.13
tapta-hema-avadātena with a luster like that of molten goldSB 8.6.3-7
avadāya cutting to piecesSB 5.26.31
avadhaḥ not killingSB 4.17.26
avadhāna glancing overCC Adi 5.65
aṃśera avadhāna manifestation of the partCC Adi 5.81
avadhāna attentionCC Madhya 6.97
kara avadhāna You consider itCC Madhya 12.33
avadhāna attentionCC Madhya 15.249
avadhāna any attentionCC Madhya 16.267
kare avadhāna glancesCC Madhya 20.272
avadhāna attentionCC Antya 15.53
sa-avadhānam approximatelySB 3.11.18
avadhāraṇe in the sense of certaintyCC Madhya 24.67
api avadhāraṇe this api is used for emphasisCC Madhya 24.171
avadhāraṇe in emphasisCC Madhya 24.185
avadhāraṇe in the matter of ascertainingCC Madhya 24.304
avadhāritam is understoodSB 11.6.28
avadhārya knowing it wellSB 3.13.26
avadhārya understandingSB 3.15.35
avadhārya after hearingSB 3.19.1
avadhārya perceivingSB 3.20.28
avadhārya knowingSB 5.4.3
avadhārya understanding surely that the child was the Supreme Personality of GodheadSB 10.3.12
avadhārya realizingSB 10.55.29
avadhāya meditationSB 3.5.42
avadhayaḥ extending toSB 5.16.8
avadhayaḥ down toBs 5.53
avadhi the highest limitCC Adi 4.48
avadhi limitationCC Adi 5.52
avadhi limitationCC Adi 11.60
sādhya-avadhi the highest limit of perfectionCC Madhya 8.96
avadhi limitCC Madhya 8.194
avadhi' the limitCC Madhya 8.196
bālya-avadhi since the days of my childhoodCC Madhya 9.26
adya-avadhi to dateCC Madhya 9.248
avadhi limitCC Madhya 9.308
pāṇḍityera avadhi the limit of learned scholarshipCC Madhya 10.110
kalpa-avadhi until the end of the millenniumCC Madhya 20.145
ā-śarīra-dhāraṇā-avadhi for as long as one still has this bodyNBS 14
avadhiḥ up to the limit ofSB 2.1.14
avadhiḥ up to the limit ofSB 2.9.21
avadhīḥ you have killedSB 4.11.7
avadhiḥ destinationSB 4.31.13
avadhiḥ the end of lifeSB 5.13.17
kāla-avadhiḥ the limited span of life (after which one's evolution may be degrading or elevating)SB 5.14.31
avadhiḥ culminating inSB 12.4.1
avadhīrita which have defiedMM 6
avadhiṣṭām the two of Them killedSB 10.46.24
avadhīt killedSB 1.7.35
avadhīt did killSB 1.17.30
avadhīt killedSB 3.3.11
avadhīt let him killSB 3.14.34
avadhīt killSB 4.6.47
avadhīt killedSB 4.12.3
avadhīt killedSB 7.1.1
avadhīt killedSB 8.1.26
avadhīt he killedSB 9.7.3
avadhīt did killSB 9.8.5-6
avadhīt killedSB 9.9.42
avadhīt have killedSB 9.15.38
avadhīt killed immediatelySB 9.16.6
avadhīt killedSB 9.17.15
avadhīt killedSB 10.1.10
avadhīt killedSB 10.38.42
avadhīt killedSB 10.44.26
avadhīt killedSB 10.57.5
avadhīyamānaḥ existing as the controllerSB 5.11.13-14
avadhṛtaḥ was certainly knownSB 10.1.22
avadhṛtaḥ being followedCC Antya 14.120
avadhūta neglected by othersSB 1.19.25
avadhūta-veṣaḥ dressed like a mendicantSB 3.1.19
avadhūta-sevitāḥ achieved by the self-realized soulsSB 4.4.21
avadhūta of the name AvadhūtaSB 4.25.48
avadhūta-veṣaḥ appearing like an avadhūta (having no concern with the material world)SB 5.5.29
avadhūta neglectedSB 5.5.31
avadhūta-veṣa-bhāṣā-caritaiḥ by the dress, language and characteristics of an avadhūtaSB 5.6.6
avadhūta O master of all mystic powerSB 5.12.1
avadhūta-lińgāḥ who remain hidden under different bodily guisesSB 5.13.23
avadhūta scatteredSB 10.37.1-2
avadhūta of the avadhūta brāhmaṇaSB 11.9.33
avadhūta the mendicantCC Adi 5.161
nityānanda avadhūta the mendicant Lord NityānandaCC Adi 6.48
avadhūta-indoḥ of Śrī NityānandaCC Adi 11.4
avadhūta paramānanda Avadhūta ParamānandaCC Adi 11.49
bhraṣṭa avadhūta reject paramahaṃsaCC Madhya 3.85
avadhūta-gosāñi Nityānanda PrabhuCC Madhya 16.39
avadhūta agitated and cleansedCC Madhya 21.18
avadhūta-ākṛtiḥ the dress of a mendicantCC Madhya 24.348
avadhūta the great devotee and mendicantCC Antya 3.149
avadhūta paramahaṃsaCC Antya 7.20
avadhūta-candra to the moon of mendicantsCC Antya 8.3
avadhūta Nityānanda PrabhuCC Antya 12.78
avadhūtaḥ without dressing (of the hair, etc.)SB 3.1.19
avadhūtaḥ called AvadhūtaSB 4.29.11
avadhūtaḥ highly elevated personSB 5.10.16
avadhūtāḥ shakenSB 7.8.32
avadhutām appearing like a mendicantSB 4.26.18
avadhūtam the unkempt brāhmaṇaSB 10.80.24
avadhūtam the mendicantSB 11.7.25
avadhūtam uncleanSB 11.23.33
sa-avadhūtam with Nityānanda PrabhuCC Antya 2.1
sa-avadhūtam with Nityānanda PrabhuCC Antya 3.1
avadhūtasya of a holy man acting outside the scope of ordinary regulative principlesSB 11.7.24
avadhūtena of the liberated wandering mendicantsSB 6.15.10
avadhūtena unwashedSB 10.80.25-26
avadhūtera jhuṭhā the remnants of the food of the avadhūtaCC Madhya 3.96
avadhūtera sańge with a mendicantCC Madhya 12.189
avadhya a cow or calf, which is not to be killedCC Antya 3.160
avadhyaḥ cannot be killedBG 2.30
avadhyaḥ not to be killedSB 10.63.47
avadhyāna because of his neglectSB 11.23.10
sat-avadhyānam neglecting a great personality like youSB 5.10.24
avadhyātaḥ thus being disrespectedSB 3.12.6
avadhyāyatha you hold in contemptSB 10.82.42
avadhyāyī one who is neglectfulSB 10.44.48
avadhyeyaḥ to be insultedSB 4.13.23
avadṛśyate is perceivedSB 3.27.12
avadya-kṛt an offenderSB 4.4.22
avadya-mṛk the cleanser of all sinsSB 10.22.20
avadya misfortuneSB 10.36.38
avadya improperSB 10.85.48-49
avadyam deplorableSB 1.6.23
avadyam great offenseSB 3.9.1
avadyam abominable (act)SB 4.11.12
avadyam offenseSB 4.13.30
avadyam abominableSB 4.19.22
avadyam harmSB 5.1.17
yathā-karma-avadyam according to how much they have violated the rules and regulations of conditional lifeSB 5.26.6
ātma-avadyam the fault you have committedSB 9.14.12
avadyan cut it upSB 10.55.5
avadyena faultySB 3.14.33
avyavadhāna without cessationSB 5.1.6
avyavadhāna by the nondifference of constitutionSB 5.5.35
avyavadhāna-ananya-bhakti-yogena by uninterrupted and unflinching devotional serviceSB 5.18.7
avyavadhānam without separationSB 3.28.35
avyavadhānena without any changeSB 4.29.60
avyavadhīyamānaḥ not being coveredSB 12.6.67
bala-vadbhiḥ toward those who are powerfulSB 10.60.12
ballava-vadhū-bandhoḥ of the friend of the gopīs, Śrī KṛṣṇaCC Antya 1.138
bālya-avadhi since the days of my childhoodCC Madhya 9.26
ballava-vadhū-bandhoḥ of the friend of the gopīs, Śrī KṛṣṇaCC Antya 1.138
bhagavadbhiḥ by youSB 3.15.36
bhagavadbhiḥ by the representatives of the Supreme Personality of GodheadSB 4.22.43
bhagavadīyatvena eva because of a relationship with the Supreme Personality of GodheadSB 5.6.17
bhāgyavadbhiḥ by the most fortunateCC Antya 20.1
avyavadhāna-ananya-bhakti-yogena by uninterrupted and unflinching devotional serviceSB 5.18.7
avadhūta-veṣa-bhāṣā-caritaiḥ by the dress, language and characteristics of an avadhūtaSB 5.6.6
bhauma-vadhe after killing kingsSB 1.10.29
bhavadbhiḥ by all of youSB 1.2.5
bhavadbhiḥ by your good selfSB 1.7.46
bhavadbhiḥ by youSB 1.18.23
bhavadbhiḥ by your good selfSB 1.19.32
bhavadbhiḥ by your good selfSB 3.2.19
bhavadbhiḥ by youSB 3.16.3
bhavadbhiḥ like your good selfSB 4.18.7
bhavadbhiḥ by youSB 5.3.17
bhavadbhiḥ by youSB 5.5.26
bhavadbhiḥ by your good selvesSB 7.7.28
bhavadbhiḥ by all of youSB 8.11.44
bhavadbhiḥ by all of you demonsSB 8.21.23
bhavadbhiḥ by your good selvesSB 10.1.22
bhavadbhiḥ by YouSB 10.41.48
bhavadbhiḥ because of youSB 11.2.9
bhavadbhiḥ youSB 11.30.47
bhavadbhiḥ by your good selvesSB 12.12.2
bhavadbhyaḥ from youSB 3.16.6
bhavadbhyām by you and your wife, YaśodāSB 10.5.27
bhavadbhyām by you twoSB 10.36.22-23
bhavadbhyām of the two of YouSB 10.41.11
bhavadbhyām You twoSB 10.43.40
bhavadbhyām by You twoSB 10.45.47
bhavadbhyām by You twoSB 10.48.17
bhavadbhyām than YouSB 10.48.18
bhavadīyā YourSB 4.7.37
bhavadīya of YourSB 4.9.12
bhavadīya-sammataḥ approved by the devotees of Your LordshipSB 8.22.8
bhavadīya-vārtām topics related to YouSB 10.14.3
bhavadīya among Your devoteesSB 10.15.6
bhavadīya Your ownSB 10.48.27
bhavadīya-vārtām discussions about You, the Supreme Personality of GodheadCC Madhya 8.67
bhavadīya in relation with YouCC Madhya 24.177
bhavadīyena of your good selfSB 9.18.39
bhīta-vadhaḥ the killing of a person who is afraidSB 6.11.4
bhraṣṭa avadhūta reject paramahaṃsaCC Madhya 3.85
bhrātṛ-vadham the killing of his brotherSB 4.10.4
bhrātuḥ vadham the killing of his brotherSB 7.4.4
brahma-vadhāt from the sin of killing a brāhmaṇaSB 3.19.37
brahma-vadhāt from the killing of a brāhmaṇaSB 6.13.15
brahma-vadhāt than killing a brāhmaṇaSB 9.15.41
bṛhat-vadhāt due to killing a brāhmaṇaSB 6.13.4
caidya-vadha the killing of ŚiśupālaSB 10.74.54
caidya-vadhe when Śiśupāla was killedSB 10.78.10
kiñcit cakāra vadanam she wore a sorry look on her faceSB 3.33.20
cāńda vadana face like the moonCC Antya 11.33
candra-vadana moon-facedCC Madhya 5.137
avadhūta-candra to the moon of mendicantsCC Antya 8.3
cāri vadana four facesCC Madhya 21.84
avadhūta-veṣa-bhāṣā-caritaiḥ by the dress, language and characteristics of an avadhūtaSB 5.6.6
deha-vadbhiḥ by the embodiedBG 12.5
deva-vadhvaḥ the wives of the demigodsSB 10.16.27
deva-vadhvaḥ O wives of the demigodsSB 11.4.8
devadattaḥ DevadattaSB 9.2.20
devadattam the conchshell named DevadattaBG 1.15
devadattam named DevadattaSB 12.2.19-20
devadhānīm DevadhānīSB 5.21.7
ā-śarīra-dhāraṇā-avadhi for as long as one still has this bodyNBS 14
dhāvadbhiḥ running awaySB 6.11.4
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
dīna-vadanām having a dry faceSB 8.16.3
sva-dṛṣṭa-vadbhiḥ by those who have perfectly realized the selfSB 2.9.9
bhagavadīyatvena eva because of a relationship with the Supreme Personality of GodheadSB 5.6.17
mālyavad-gandha-mādanau the demarcation mountains of Mālyavān on the west and Gandhamādana on the eastSB 5.16.10
vraja-vadhū-gaṇera of the young wives of VrajaCC Adi 4.48
go-vadha the killing of cowsCC Adi 17.157
go-vadhera for cow-killingCC Adi 17.158
go-vadha cow-killingCC Adi 17.158
go-vadha cow-killingCC Adi 17.159
go-vadha cow-killingCC Adi 17.159
go-vadha killing of cowsCC Adi 17.163
go-vadhī the killer of a cowCC Adi 17.166
go-vadha kare who kill cowsCC Antya 3.155
gopa-vadhvaḥ the cowherd damselsSB 1.9.40
gopa-vadhvaḥ the young cowherd womenSB 10.47.58
gopa-vadhū-viṭena by a boy engaged in joking with the gopīsCC Madhya 10.178
gopa-vadhūṭī of the cowherd girlsCC Madhya 19.98
gopa-vadhū-viṭena engaged in joking with the gopīsCC Madhya 24.133
avadhūta-gosāñi Nityānanda PrabhuCC Madhya 16.39
govinda-vadana the face of Lord KṛṣṇaCC Madhya 21.131
ha-io sāvadhāna kindly be attentiveCC Madhya 5.75
sāvadhāna ha-ibā you should be very carefulCC Antya 13.87
navadvīpa haite from NavadvīpaCC Madhya 3.157
tapta-hema-avadātena with a luster like that of molten goldSB 8.6.3-7
hiraṇyākṣa-vadham of the killing of HiraṇyākṣaSB 3.19.37
hiraṇyākṣa-vadhaḥ the killing of the demon HiraṇyākṣaSB 12.12.10
hṛdaya-vadanaḥ his heart and faceSB 5.26.36
sāvadhāna ha-ibā you should be very carefulCC Antya 13.87
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
avadhūta-indoḥ of Śrī NityānandaCC Adi 11.4
indu-vadanā moon-facedCC Antya 1.151
ha-io sāvadhāna kindly be attentiveCC Madhya 5.75
putra-vadha-īpsuḥ desirous of killing his own sonSB 7.8.16
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
jagat-vadhāt from the sin for killing the whole worldSB 6.13.7
puṇya-jana-vadhūnām who are wives of the most pious YakṣasSB 5.16.18
jarāsandha-vadhaḥ the killing of JarāsandhaSB 10.71.10
jarāsandha-vadham the killing of JarāsandhaSB 10.74.1
avadhūtera jhuṭhā the remnants of the food of the avadhūtaCC Madhya 3.96
tāre vadha kaile if he is killedCC Madhya 15.261
kāla-avadhiḥ the limited span of life (after which one's evolution may be degrading or elevating)SB 5.14.31
kalpa-avadhi until the end of the millenniumCC Madhya 20.145
kara avadhāna You consider itCC Madhya 12.33
kare avadhāna glancesCC Madhya 20.272
go-vadha kare who kill cowsCC Antya 3.155
yathā-karma-avadyam according to how much they have violated the rules and regulations of conditional lifeSB 5.26.6
kiñcit cakāra vadanam she wore a sorry look on her faceSB 3.33.20
lakṣa koṭi-vadana possessing a hundred thousand and ten million facesCC Madhya 21.68
kṛṣṇa-vadhvaḥ the consorts of Lord KṛṣṇaSB 10.33.7
avadya-kṛt an offenderSB 4.4.22
tat-vyavadhāna-kṛt who created an obstruction to the sun and moon at the time of the distribution of nectarSB 5.24.2
kurvadbhiḥ which are actingSB 12.10.31-32
lakṣa koṭi-vadana possessing a hundred thousand and ten million facesCC Madhya 21.68
anavadya-lakṣaṇam as bearing the characteristics of a dull animal because of a fat body like a bull's and because of being deaf and dumbSB 5.9.14
avadhūta-lińgāḥ who remain hidden under different bodily guisesSB 5.13.23
mālyavad-gandha-mādanau the demarcation mountains of Mālyavān on the west and Gandhamādana on the eastSB 5.16.10
mahā-vadānyāya who is most munificent and charitably disposedCC Madhya 19.53
malina-vadana with a morose faceCC Madhya 14.137
mālyavad-gandha-mādanau the demarcation mountains of Mālyavān on the west and Gandhamādana on the eastSB 5.16.10
mat-vadha-artham for the purpose of killing meSB 1.9.38
me vadataḥ as I am speakingSB 4.29.52
mṛga-vadhūḥ wife of a deerSB 5.8.4
mṛga-vadhū-nyāsaḥ this baby deer entrusted to me by its motherSB 5.8.19
avadya-mṛk the cleanser of all sinsSB 10.22.20
muralī-vadana holding a flute to His mouthCC Adi 17.279
muralī-vadana playing the fluteCC Madhya 2.15
muralī-vadana with a flute to the mouthCC Antya 14.18
muralī-vadana Kṛṣṇa with His flute to His mouthCC Antya 14.32
muralī-vadana with His flute to His lipsCC Antya 15.56
muralī-vadana with His flute to His lipsCC Antya 15.61
muralī-vadana Lord Kṛṣṇa with His flute to the mouthCC Antya 16.85
na vadhyaḥ not to be killedSB 7.10.27
na vadhyaḥ not to be killedSB 10.63.47
na vadasi you do not speakSB 10.90.22
na vadet should not speakSB 11.11.17
nāga-vadhvaḥ the wives of the serpent demonSB 5.17.20
nakra-vadanam the mouth of the crocodileSB 2.7.16
nārī-vadhe for killing womenCC Antya 15.73
nārī-vadhe in killing one womanCC Antya 19.51
navadhā in nine phasesSB 12.11.31
navadvīpa NavadvīpaCC Adi 13.30
navadvīpa NavadvīpaCC Adi 13.33
navadvīpa the whole city of NavadvīpaCC Adi 17.211
navadvīpa-vāsī the inhabitants of NavadvīpaCC Madhya 3.153-155
navadvīpa haite from NavadvīpaCC Madhya 3.157
navadvīpa-vāsī all the inhabitants of NavadvīpaCC Madhya 3.188
navadvīpa āila came to NavadvīpaCC Antya 2.160
navadvīpe at NavadvīpaCC Adi 3.30
navadvīpe in NavadvīpaCC Adi 4.271-272
navadvīpe at NavadvīpaCC Adi 5.6
navadvīpe in NavadvīpaCC Adi 9.8
navadvīpe puruṣottama Puruṣottama of NavadvīpaCC Adi 11.33
navadvīpe at NavadvīpaCC Adi 13.8
navadvīpe in the city of NavadvīpaCC Adi 13.106
navadvīpe in NavadvīpaCC Adi 16.16
navadvīpe in NavadvīpaCC Adi 16.20
navadvīpe the holy place of Navadvīpa-dhāmaCC Madhya 1.193
navadvīpe to NavadvīpaCC Madhya 3.22
navadvīpe as well as NavadvīpaCC Madhya 3.183
navadvīpe in NavadvīpaCC Madhya 6.51
navadvīpe at NavadvīpaCC Madhya 7.109
navadvīpe to NavadvīpaCC Madhya 10.75
navadvīpe at NavadvīpaCC Madhya 10.88
navadvīpe at NavadvīpaCC Madhya 10.103
navadvīpe to NavadvīpaCC Madhya 16.250
navadvīpe at NavadvīpaCC Antya 3.86
navadvīpe at NavadvīpaCC Antya 12.8
navadvīpe āsi' coming to NavadvīpaCC Antya 12.9
nija-vadana-salila the water from its mouthSB 5.8.25
niravadhi unboundedCC Adi 4.48
niravadhi continuouslyCC Adi 5.121
niravadhi alwaysCC Adi 8.70
niravadhi alwaysCC Adi 9.51
niravadhi constantlyCC Madhya 9.308
niravadhi without stoppingCC Madhya 17.129
niravadhi continuouslyCC Antya 4.31
niravadya-saṃyujām to those who are completely free from deceitSB 10.32.22
niravadya-saṃyujām to those who are completely free from deceitCC Adi 4.180
niravadya without duplicityCC Madhya 8.93
niravadya-saṃyujām to those who are completely free from deceitCC Antya 7.44
niravadyam uncontaminatedSB 3.25.12
niravadyam without any faultSB 8.8.19
niravadyasya freed from all attachmentSB 1.9.21
niravadyatvāt due to the supreme utility of that instructionSB 7.8.1
nityānanda avadhūta the mendicant Lord NityānandaCC Adi 6.48
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
nṛpa-vadhūḥ the princessSB 3.21.28
mṛga-vadhū-nyāsaḥ this baby deer entrusted to me by its motherSB 5.8.19
nyavadat spokeSB 4.12.1
nyavadhīḥ you killedSB 10.51.62
nyavadhīt killedSB 10.3.22
pāṇḍityera avadhi the limit of learned scholarshipCC Madhya 10.110
avadhūta paramānanda Avadhūta ParamānandaCC Adi 11.49
paraśvadha chopperSB 9.15.29
paraśvadhaḥ being expert in using his weapon, the paraśu, or chopperSB 9.15.31
paraśvadhaiḥ and lancesSB 4.10.11-12
paraśvadhaiḥ by axesSB 6.10.23
paraśvadhaiḥ with the weapons called paraśvadhaSB 8.10.36
paraśvadhena by the great chopperSB 2.7.22
paryādravadbhiḥ running all aroundSB 4.5.13
pitṛ-vadham the killing of his fatherSB 9.16.17
sva-pituḥ vadham their father's having been killed (by Paraśurāma)SB 9.16.9
prahasat-vadanaḥ whose face began to smile when he saw the wonderful childSB 10.11.6
prahṛṣṭa-vadanaḥ being very happy and smilingSB 9.14.33
pralamba-vadham the killing of PralambāsuraSB 10.20.1
prasanna-vadanam with a smiling faceSB 3.33.23
prasanna-vadana-ambhojaḥ Vasudeva, who externally presented himself as if very happySB 10.1.53
sva-vadham prati fearing his own death from ViṣṇuSB 10.1.65-66
pravadāmi I shall explainSB 10.52.42
pravadanti sayBG 2.42-43
pravadanti sayBG 5.4
pravadanti they callSB 3.25.31
pravadanti is calledSB 11.3.37
pravadanti they go on discussingSB 11.5.10
pravadataḥ while describingSB 1.9.29
pravadatām of argumentsBG 10.32
pravadati thus having spokenSB 1.17.21
pravadati was speaking very philosophicallySB 7.2.58
priyam-vadaḥ who speaks very pleasinglyCC Madhya 23.71
punar-ukta-vad-ābhāsa tinge of punar-ukta-vatCC Adi 16.77
puṇya-jana-vadhūnām who are wives of the most pious YakṣasSB 5.16.18
navadvīpe puruṣottama Puruṣottama of NavadvīpaCC Adi 11.33
pūtanā-vadha-ādi killing of the demons like PūtanāCC Madhya 20.381
pūtanā-vadha-ādi killing the demons, beginning from PūtanāCC Madhya 20.394
putra-vadha-īpsuḥ desirous of killing his own sonSB 7.8.16
rakṣaḥ-vadhāya to kill the demon RāvaṇaSB 5.19.5
rakṣaḥ-vadhaḥ killing the Rākṣasa (Rāvaṇa)SB 9.11.20
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
sa-avadhānam approximatelySB 3.11.18
sa-vadhvaḥ with His wifeSB 10.63.50
sa-avadhūtam with Nityānanda PrabhuCC Antya 2.1
sa-avadhūtam with Nityānanda PrabhuCC Antya 3.1
sādhya-avadhi the highest limit of perfectionCC Madhya 8.96
sahasra-vadanaḥ having thousands of hoodsSB 10.1.24
sahasra vadana thousands of facesCC Adi 5.100-101
sahasra-vadane in thousands of mouthsCC Adi 5.121
sahasra-vadane in thousands of mouthsCC Adi 5.234
sahasra-vadane with thousands of mouthsCC Adi 6.78
sahasra vadane in thousands of mouthsCC Adi 10.162
sahasra-vadana Lord Śeṣa, who has thousands of mouthsCC Adi 10.163
sahasra-vadana the thousand-mouthed Śeṣa Nāga, on whom Lord Viṣṇu liesCC Adi 11.60
sahasra-vadane by thousands of mouthsCC Adi 13.45
sahasra-vadana Lord Śeṣa Nāga, who has thousands of hoodsCC Madhya 8.303
sahasra-vadana the thousand-mouthed ŚeṣaCC Madhya 14.202
sahasra-vadana Lord Śeṣa, who has thousands of hoodsCC Madhya 14.256
sahasra-vadana possessing thousands of mouthsCC Madhya 15.158
sahasra-vadane in thousands of mouthsCC Madhya 16.289
sahasra-vadana Lord Śeṣa, who has thousands of hoodsCC Madhya 18.223
sahasra-vadane in thousands of mouthsCC Madhya 21.12
sahasra-vadane as if with a thousand mouthsCC Antya 1.192
sahasra-vadane in thousands of mouthsCC Antya 18.13
sahasra-vadane with His thousands of facesCC Antya 20.70
śakra-vadha killing the King of heavenSB 4.19.27
nija-vadana-salila the water from its mouthSB 5.8.25
samavadhāritam sufficiently understoodSB 11.29.29
bhavadīya-sammataḥ approved by the devotees of Your LordshipSB 8.22.8
saṃstuvadbhiḥ who were offering their prayers alsoSB 8.3.31
saṃvadatām conversingSB 10.86.46
saṃvadatoḥ were conversingSB 3.20.5
saṃvadiṣyāmaḥ we shall converseSB 12.10.7
niravadya-saṃyujām to those who are completely free from deceitSB 10.32.22
niravadya-saṃyujām to those who are completely free from deceitCC Adi 4.180
niravadya-saṃyujām to those who are completely free from deceitCC Antya 7.44
avadhūtera sańge with a mendicantCC Madhya 12.189
vraja-vadhū-sańge in the association of the damsels of VrajabhūmiCC Antya 5.45-46
sapta-vadhriḥ bound by the seven layersSB 3.31.11
sapta-vadhriḥ bound by the seven layers of material coveringsSB 3.31.19
śarīra-vadana heads on the bodyCC Madhya 21.86
ā-śarīra-dhāraṇā-avadhi for as long as one still has this bodyNBS 14
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
sarva-artha-vadhaḥ killing all beneficial opportunitiesSB 9.9.28
sarvadā alwaysSB 2.2.36
sarvadā in all circumstancesSB 2.9.36
sarvadā alwaysSB 4.4.13
sarvadā alwaysSB 6.17.18
sarvadā alwaysSB 10.8.7
sarvadā alwaysCC Adi 1.56
sarvadā alwaysCC Adi 4.123
sarvadā alwaysCC Adi 4.130
sarvadā alwaysCC Adi 4.234
sarvadā alwaysCC Adi 5.88
sarvadā alwaysCC Madhya 22.34
sarvadā alwaysCC Madhya 23.34
sarvadā alwaysCC Madhya 23.36
sarvadā alwaysCC Madhya 24.224
sarvadā alwaysCC Madhya 25.123
sarvadā alwaysNBS 79
sarvadāi alwaysCC Antya 6.25
sat-avadhyānam neglecting a great personality like youSB 5.10.24
sāvadhāna attentionCC Adi 13.108
sāvadhāna carefullyCC Adi 16.61
sāvadhāna very carefulCC Madhya 2.19
ha-io sāvadhāna kindly be attentiveCC Madhya 5.75
sāvadhāna always carefulCC Madhya 8.32
sāvadhāna carefulCC Madhya 11.122
sāvadhāna very carefulCC Madhya 13.4
sāvadhāna warningCC Madhya 13.185
sāvadhāna careCC Antya 3.22
sāvadhāna care of other ritualsCC Antya 11.61
sāvadhāna ha-ibā you should be very carefulCC Antya 13.87
sāvadhāne very carefullyCC Madhya 3.21
sāvadhāne with careCC Madhya 4.43
sāvadhāne very carefullyCC Madhya 6.88
sāvadhāne carefulCC Madhya 13.183
śuna sāvadhāne carefully please hearCC Madhya 14.218
sāvadhāne with attentionCC Madhya 24.229
sāvadhāne with great careCC Antya 6.312
sāvadhāne with great careCC Antya 13.34
śevadhiḥ a great treasureSB 11.2.30
sevadhiḥ a treasureCC Madhya 22.85
śevadhim the bestower of all desired, who is just like a vast treasureSB 3.24.16
avadhūta-sevitāḥ achieved by the self-realized soulsSB 4.4.21
śivadam well-beingSB 1.1.2
sravadbhiḥ flowingSB 4.1.18
śrī-vadana-ambujaḥ having a beautiful lotus faceSB 8.18.2
śrī-vadane from Your beautiful faceCC Madhya 5.94
śṛṇvadbhiḥ who were accustomed to hearSB 9.4.24
stuvadbhiḥ who were offering praiseSB 10.55.25
sudhā-aṃśu-vadana whose face is like the moonCC Adi 3.44
suhṛt-vadham killing of his family membersSB 9.16.8
śuna sāvadhāne carefully please hearCC Madhya 14.218
śuṣyat-vadana drying up of the mouthSB 1.15.2
sva-dṛṣṭa-vadbhiḥ by those who have perfectly realized the selfSB 2.9.9
sva-vadanāni their own facesSB 5.25.4
sva-pituḥ vadham their father's having been killed (by Paraśurāma)SB 9.16.9
sva-vadham prati fearing his own death from ViṣṇuSB 10.1.65-66
svadhā oblationBG 9.16
svadhā the ingredients to perform sacrificesSB 2.7.38
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
svadhā SvadhāSB 4.1.63
svadhā SvadhāSB 4.1.64
svadhā the offering to the forefathersSB 4.7.45
svadhā SvadhāSB 6.6.19
svadhā by offering the mantra svadhāSB 11.17.50
svadhāmā-ākhyaḥ SvadhāmāSB 8.13.29
svadhayati is giving me pleasureSB 5.8.25
svadhiṣṇyam his lotus seatSB 2.9.5
svadhiṣṇyam on his lotus seatSB 2.9.7
svadhītam studiedSB 4.30.39-40
svadhītam well learnedSB 7.5.22
svadhitinā by a swordSB 5.26.31
śyāma-avadātam beautiful with black colorSB 3.4.7
śyāma-avadātaḥ whose body is blackish and free from inebrietySB 8.18.2
tāhāra vadana his faceCC Antya 2.117
tapta-hema-avadātena with a luster like that of molten goldSB 8.6.3-7
tāre vadha kaile if he is killedCC Madhya 15.261
tat-vadhaḥ killing of himSB 1.7.37
tat-vyavadhāna-kṛt who created an obstruction to the sun and moon at the time of the distribution of nectarSB 5.24.2
tat-vadhāya for the killing of himSB 6.13.4
tat-vadha-upāyān various means for killing himSB 7.5.42
tat-vadham the killing of HiraṇyākṣaSB 8.19.7
tat-vadha-upāyaḥ the only means of killing Him (Viṣṇu)SB 10.4.42
tattvadarśa-ādyāḥ and others, like TattvadarśaSB 8.13.31
tāvadbhiḥ by so manySB 5.22.16
tāvadbhiḥ immediatelySB 8.10.42
tāvadbhiḥ with so manySB 8.11.21
tāvadbhiḥ with as manySB 10.68.9-10
tvadīya YourSB 3.9.5
tvadīya YourMM 33
tvadīyam yourSB 4.4.23
tvadīyam yourSB 10.39.21
tvadīyām yourSB 10.58.40
tvadīyam YourSB 10.70.27
tvadīyam YourSB 11.29.38
tvadīyayā Your ownSB 10.51.45
vīrye tvadīye in the daughters begotten by youSB 3.21.29
tvadīye in yourSB 12.2.27-28
tvāṣṭra-vadhaḥ the killing of Vṛtrāsura, the son of TvaṣṭāSB 6.13.19-20
punar-ukta-vad-ābhāsa tinge of punar-ukta-vatCC Adi 16.77
dhīḥ, dhṛti, rasalā, umā, niyut, sarpiḥ, ilā, ambikā, irāvatī, svadhā, dīkṣā rudrāṇyaḥ the eleven RudrāṇīsSB 3.12.13
tat-vadha-upāyaḥ the only means of killing Him (Viṣṇu)SB 10.4.42
tat-vadha-upāyān various means for killing himSB 7.5.42
utphulla-vadanaḥ bright-facedSB 8.5.19-20
punar-ukta-vad-ābhāsa tinge of punar-ukta-vatCC Adi 16.77
priyam-vadaḥ who speaks very pleasinglyCC Madhya 23.71
śuṣyat-vadana drying up of the mouthSB 1.15.2
nija-vadana-salila the water from its mouthSB 5.8.25
śrī-vadana-ambujaḥ having a beautiful lotus faceSB 8.18.2
prasanna-vadana-ambhojaḥ Vasudeva, who externally presented himself as if very happySB 10.1.53
sudhā-aṃśu-vadana whose face is like the moonCC Adi 3.44
sahasra vadana thousands of facesCC Adi 5.100-101
sahasra-vadana Lord Śeṣa, who has thousands of mouthsCC Adi 10.163
sahasra-vadana the thousand-mouthed Śeṣa Nāga, on whom Lord Viṣṇu liesCC Adi 11.60
muralī-vadana holding a flute to His mouthCC Adi 17.279
muralī-vadana playing the fluteCC Madhya 2.15
vaṃśī-vadana the person with the fluteCC Madhya 2.55
candra-vadana moon-facedCC Madhya 5.137
sahasra-vadana Lord Śeṣa Nāga, who has thousands of hoodsCC Madhya 8.303
malina-vadana with a morose faceCC Madhya 14.137
sahasra-vadana the thousand-mouthed ŚeṣaCC Madhya 14.202
sahasra-vadana Lord Śeṣa, who has thousands of hoodsCC Madhya 14.256
sahasra-vadana possessing thousands of mouthsCC Madhya 15.158
sahasra-vadana Lord Śeṣa, who has thousands of hoodsCC Madhya 18.223
lakṣa koṭi-vadana possessing a hundred thousand and ten million facesCC Madhya 21.68
cāri vadana four facesCC Madhya 21.84
śarīra-vadana heads on the bodyCC Madhya 21.86
govinda-vadana the face of Lord KṛṣṇaCC Madhya 21.131
indu-vadanā moon-facedCC Antya 1.151
tāhāra vadana his faceCC Antya 2.117
cāńda vadana face like the moonCC Antya 11.33
muralī-vadana with a flute to the mouthCC Antya 14.18
muralī-vadana Kṛṣṇa with His flute to His mouthCC Antya 14.32
muralī-vadana with His flute to His lipsCC Antya 15.56
muralī-vadana with His flute to His lipsCC Antya 15.61
muralī-vadana Lord Kṛṣṇa with His flute to the mouthCC Antya 16.85
vikasita-vadanāḥ with bright facesSB 5.9.14
hṛdaya-vadanaḥ his heart and faceSB 5.26.36
utphulla-vadanaḥ bright-facedSB 8.5.19-20
prahṛṣṭa-vadanaḥ being very happy and smilingSB 9.14.33
sahasra-vadanaḥ having thousands of hoodsSB 10.1.24
prahasat-vadanaḥ whose face began to smile when he saw the wonderful childSB 10.11.6
adhaḥ-vadanam downward faceSB 1.14.23
aśru-vadanām with tears on the faceSB 1.16.18
āśru-vadanām with tears in her eyesSB 1.17.3
nakra-vadanam the mouth of the crocodileSB 2.7.16
kiñcit cakāra vadanam she wore a sorry look on her faceSB 3.33.20
prasanna-vadanam with a smiling faceSB 3.33.23
dīna-vadanām having a dry faceSB 8.16.3
sva-vadanāni their own facesSB 5.25.4
agha-vadanāt from the mouth of AghāsuraSB 10.13.4
sahasra-vadane in thousands of mouthsCC Adi 5.121
sahasra-vadane in thousands of mouthsCC Adi 5.234
sahasra-vadane with thousands of mouthsCC Adi 6.78
sahasra vadane in thousands of mouthsCC Adi 10.162
sahasra-vadane by thousands of mouthsCC Adi 13.45
vaṃśī-vadane Lord Kṛṣṇa's face with His fluteCC Madhya 2.37
śrī-vadane from Your beautiful faceCC Madhya 5.94
sahasra-vadane in thousands of mouthsCC Madhya 16.289
sahasra-vadane in thousands of mouthsCC Madhya 21.12
āpana-vadane personally, with His own mouthCC Madhya 25.267
sahasra-vadane as if with a thousand mouthsCC Antya 1.192
sahasra-vadane in thousands of mouthsCC Antya 18.13
sahasra-vadane with His thousands of facesCC Antya 20.70
adbhuta-vadānya wonderfully magnanimousCC Antya 17.68
mahā-vadānyāya who is most munificent and charitably disposedCC Madhya 19.53
na vadasi you do not speakSB 10.90.22
me vadataḥ as I am speakingSB 4.29.52
deha-vadbhiḥ by the embodiedBG 12.5
sva-dṛṣṭa-vadbhiḥ by those who have perfectly realized the selfSB 2.9.9
bala-vadbhiḥ toward those who are powerfulSB 10.60.12
ātma-vadbhiḥ by those who are self-controlledSB 11.6.10
na vadet should not speakSB 11.11.17
mat-vadha-artham for the purpose of killing meSB 1.9.38
śakra-vadha killing the King of heavenSB 4.19.27
tat-vadha-upāyān various means for killing himSB 7.5.42
putra-vadha-īpsuḥ desirous of killing his own sonSB 7.8.16
tat-vadha-upāyaḥ the only means of killing Him (Viṣṇu)SB 10.4.42
caidya-vadha the killing of ŚiśupālaSB 10.74.54
go-vadha the killing of cowsCC Adi 17.157
go-vadha cow-killingCC Adi 17.158
go-vadha cow-killingCC Adi 17.159
go-vadha cow-killingCC Adi 17.159
go-vadha killing of cowsCC Adi 17.163
tāre vadha kaile if he is killedCC Madhya 15.261
pūtanā-vadha-ādi killing of the demons like PūtanāCC Madhya 20.381
pūtanā-vadha-ādi killing the demons, beginning from PūtanāCC Madhya 20.394
go-vadha kare who kill cowsCC Antya 3.155
tat-vadhaḥ killing of himSB 1.7.37
bhīta-vadhaḥ the killing of a person who is afraidSB 6.11.4
tvāṣṭra-vadhaḥ the killing of Vṛtrāsura, the son of TvaṣṭāSB 6.13.19-20
sarva-artha-vadhaḥ killing all beneficial opportunitiesSB 9.9.28
rakṣaḥ-vadhaḥ killing the Rākṣasa (Rāvaṇa)SB 9.11.20
jarāsandha-vadhaḥ the killing of JarāsandhaSB 10.71.10
hiraṇyākṣa-vadhaḥ the killing of the demon HiraṇyākṣaSB 12.12.10
hiraṇyākṣa-vadham of the killing of HiraṇyākṣaSB 3.19.37
bhrātṛ-vadham the killing of his brotherSB 4.10.4
bhrātuḥ vadham the killing of his brotherSB 7.4.4
tat-vadham the killing of HiraṇyākṣaSB 8.19.7
suhṛt-vadham killing of his family membersSB 9.16.8
sva-pituḥ vadham their father's having been killed (by Paraśurāma)SB 9.16.9
pitṛ-vadham the killing of his fatherSB 9.16.17
sva-vadham prati fearing his own death from ViṣṇuSB 10.1.65-66
pralamba-vadham the killing of PralambāsuraSB 10.20.1
jarāsandha-vadham the killing of JarāsandhaSB 10.74.1
brahma-vadhāt from the sin of killing a brāhmaṇaSB 3.19.37
bṛhat-vadhāt due to killing a brāhmaṇaSB 6.13.4
jagat-vadhāt from the sin for killing the whole worldSB 6.13.7
brahma-vadhāt from the killing of a brāhmaṇaSB 6.13.15
brahma-vadhāt than killing a brāhmaṇaSB 9.15.41
vṛtra-vadhataḥ from killing VṛtrāsuraSB 11.4.19
rakṣaḥ-vadhāya to kill the demon RāvaṇaSB 5.19.5
tat-vadhāya for the killing of himSB 6.13.4
bhauma-vadhe after killing kingsSB 1.10.29
caidya-vadhe when Śiśupāla was killedSB 10.78.10
nārī-vadhe for killing womenCC Antya 15.73
nārī-vadhe in killing one womanCC Antya 19.51
go-vadhera for cow-killingCC Adi 17.158
go-vadhī the killer of a cowCC Adi 17.166
sapta-vadhriḥ bound by the seven layersSB 3.31.11
sapta-vadhriḥ bound by the seven layers of material coveringsSB 3.31.19
mṛga-vadhū-nyāsaḥ this baby deer entrusted to me by its motherSB 5.8.19
vraja-vadhū-gaṇera of the young wives of VrajaCC Adi 4.48
gopa-vadhū-viṭena by a boy engaged in joking with the gopīsCC Madhya 10.178
vraja-vadhū all the damsels of VṛndāvanaCC Madhya 13.158
vraja-vadhū of the damsels of VrajabhūmiCC Madhya 20.180
gopa-vadhū-viṭena engaged in joking with the gopīsCC Madhya 24.133
ballava-vadhū-bandhoḥ of the friend of the gopīs, Śrī KṛṣṇaCC Antya 1.138
vraja-vadhū-sańge in the association of the damsels of VrajabhūmiCC Antya 5.45-46
vraja-vadhūbhiḥ with the young women of VṛndāvanaSB 10.33.39
vraja-vadhūbhiḥ the damsels of Vraja, the gopīsCC Antya 5.48
nṛpa-vadhūḥ the princessSB 3.21.28
mṛga-vadhūḥ wife of a deerSB 5.8.4
vibudha-vadhūm the celestial girlSB 5.2.17
puṇya-jana-vadhūnām who are wives of the most pious YakṣasSB 5.16.18
asura-vadhūnām of the wives of those demonsSB 5.24.15
gopa-vadhūṭī of the cowherd girlsCC Madhya 19.98
gopa-vadhvaḥ the cowherd damselsSB 1.9.40
nāga-vadhvaḥ the wives of the serpent demonSB 5.17.20
deva-vadhvaḥ the wives of the demigodsSB 10.16.27
kṛṣṇa-vadhvaḥ the consorts of Lord KṛṣṇaSB 10.33.7
gopa-vadhvaḥ the young cowherd womenSB 10.47.58
sa-vadhvaḥ with His wifeSB 10.63.50
deva-vadhvaḥ O wives of the demigodsSB 11.4.8
vara-vadhvoḥ of the bridegroom and the brideSB 10.1.33
vara-vadhvoḥ for the groom and the brideSB 10.86.12
na vadhyaḥ not to be killedSB 7.10.27
na vadhyaḥ not to be killedSB 10.63.47
vaiśvadeve in connection with Vaiśvadeva, the Supreme Personality of GodheadSB 9.4.4-5
vaṃśī-vadane Lord Kṛṣṇa's face with His fluteCC Madhya 2.37
vaṃśī-vadana the person with the fluteCC Madhya 2.55
vara-vadhvoḥ of the bridegroom and the brideSB 10.1.33
vara-vadhvoḥ for the groom and the brideSB 10.86.12
bhavadīya-vārtām topics related to YouSB 10.14.3
bhavadīya-vārtām discussions about You, the Supreme Personality of GodheadCC Madhya 8.67
navadvīpa-vāsī the inhabitants of NavadvīpaCC Madhya 3.153-155
navadvīpa-vāsī all the inhabitants of NavadvīpaCC Madhya 3.188
vāvadūkaḥ expert in speakingCC Madhya 23.71
avadhūta-veṣa-bhāṣā-caritaiḥ by the dress, language and characteristics of an avadhūtaSB 5.6.6
avadhūta-veṣaḥ dressed like a mendicantSB 3.1.19
avadhūta-veṣaḥ appearing like an avadhūta (having no concern with the material world)SB 5.5.29
vibudha-vadhūm the celestial girlSB 5.2.17
vidvadbhiḥ by the learnedSB 3.6.37
vidvadbhiḥ aware ofSB 4.14.12
vikasita-vadanāḥ with bright facesSB 5.9.14
vīrye tvadīye in the daughters begotten by youSB 3.21.29
viśvadhāra ViśvadhāraSB 5.20.25
gopa-vadhū-viṭena by a boy engaged in joking with the gopīsCC Madhya 10.178
gopa-vadhū-viṭena engaged in joking with the gopīsCC Madhya 24.133
vivadamānau arguingSB 10.64.18
vivadamānayoḥ when the two parties were fightingSB 9.14.11
vivadan sometimes exclaiming loudlySB 5.14.38
vivadatām for those who argueSB 11.22.5
vraja-vadhūbhiḥ with the young women of VṛndāvanaSB 10.33.39
vraja-vadhū-gaṇera of the young wives of VrajaCC Adi 4.48
vraja-vadhū all the damsels of VṛndāvanaCC Madhya 13.158
vraja-vadhū of the damsels of VrajabhūmiCC Madhya 20.180
vraja-vadhū-sańge in the association of the damsels of VrajabhūmiCC Antya 5.45-46
vraja-vadhūbhiḥ the damsels of Vraja, the gopīsCC Antya 5.48
vṛtra-vadhataḥ from killing VṛtrāsuraSB 11.4.19
tat-vyavadhāna-kṛt who created an obstruction to the sun and moon at the time of the distribution of nectarSB 5.24.2
vyavadhānam differenceSB 4.22.27
vyavadhānena by the terminationSB 4.29.76-77
vyavadhāt made any differenceSB 1.6.4
vyavadhīyate is separatedSB 4.29.70
yathā-karma-avadyam according to how much they have violated the rules and regulations of conditional lifeSB 5.26.6
avyavadhāna-ananya-bhakti-yogena by uninterrupted and unflinching devotional serviceSB 5.18.7
DCS with thanks
330 results
vad noun (masculine) [gramm.] the root vad
Frequency rank 30041/72933
vad verb (class 1 ātmanepada) to address (Monier-Williams, Sir M. (1988))
to adjudge (Monier-Williams, Sir M. (1988))
to affirm (Monier-Williams, Sir M. (1988))
to announce (Monier-Williams, Sir M. (1988))
to declare (Monier-Williams, Sir M. (1988))
to designate (Monier-Williams, Sir M. (1988))
to foretell (Monier-Williams, Sir M. (1988))
to recommend (Monier-Williams, Sir M. (1988))
to say (Monier-Williams, Sir M. (1988))
to speak (Monier-Williams, Sir M. (1988))
to talk with (Monier-Williams, Sir M. (1988))
to tell (Monier-Williams, Sir M. (1988))

Frequency rank 227/72933
vada adjective a speaker (Monier-Williams, Sir M. (1988))
speaking (Monier-Williams, Sir M. (1988))
speaking well or sensibly (Monier-Williams, Sir M. (1988))

Frequency rank 39029/72933
vada noun (masculine) name of the first Veda (with the Magians) (Monier-Williams, Sir M. (1988))
[gramm.] the root vad
Frequency rank 22184/72933
vadana noun (neuter) (in alg.) the first term (Monier-Williams, Sir M. (1988))
(in geom.) the side opposite to the base (Monier-Williams, Sir M. (1988))
countenance (Monier-Williams, Sir M. (1988))
face (Monier-Williams, Sir M. (1988))
initial quantity or term of a progression (Monier-Williams, Sir M. (1988))
point (Monier-Williams, Sir M. (1988))
sounding (Monier-Williams, Sir M. (1988))
talking (Monier-Williams, Sir M. (1988))
the act of speaking (Monier-Williams, Sir M. (1988))
the front (Monier-Williams, Sir M. (1988))
the mouth (Monier-Williams, Sir M. (1988))
the summit or apex of a triangle (Monier-Williams, Sir M. (1988))

Frequency rank 1032/72933
vadanaka noun (neuter) face mouth
Frequency rank 64532/72933
vadanavant adjective
Frequency rank 64533/72933
vadanendu noun (masculine) the face (Monier-Williams, Sir M. (1988))

Frequency rank 64534/72933
vadanodara noun (neuter) the jaws (Monier-Williams, Sir M. (1988))

Frequency rank 64535/72933
vadh verb (class 4 parasmaipada) to destroy (Monier-Williams, Sir M. (1988))
to kill (Monier-Williams, Sir M. (1988))
to murder (Monier-Williams, Sir M. (1988))
to strike (Monier-Williams, Sir M. (1988))
*mṛ
Frequency rank 826/72933
vadha noun (masculine) capital punishment killing murder name of a Rākṣasa slaughter māraṇa (?) [gramm.] substitute vadha- (for han-)
Frequency rank 404/72933
vadhajīvin noun (masculine) a butcher (Monier-Williams, Sir M. (1988))
hunter (Monier-Williams, Sir M. (1988))

Frequency rank 39031/72933
vadhaka noun (masculine) a murderer (Monier-Williams, Sir M. (1988))
a particular sort of reed (Monier-Williams, Sir M. (1988))
an executioner (Monier-Williams, Sir M. (1988))
assassin (Monier-Williams, Sir M. (1988))
hangman (Monier-Williams, Sir M. (1988))

Frequency rank 19983/72933
vadhaka adjective destructive (Monier-Williams, Sir M. (1988))
intending to strike or kill (Monier-Williams, Sir M. (1988))
killing (Monier-Williams, Sir M. (1988))

Frequency rank 64538/72933
vadhi noun (masculine) [gramm.] root vadh
Frequency rank 64537/72933
vadhra noun (masculine neuter) a leathern strap or thong (Monier-Williams, Sir M. (1988))

Frequency rank 30042/72933
vadhri adjective castrated (Monier-Williams, Sir M. (1988))
emasculated (Monier-Williams, Sir M. (1988))
unmanly (opp. to vṛṣan) (Monier-Williams, Sir M. (1988))

Frequency rank 64540/72933
vadhryaśva noun (masculine) name of a king
Frequency rank 25277/72933
vadhu noun (feminine) a daughter in-law (Monier-Williams, Sir M. (1988))
a young wife or woman (Monier-Williams, Sir M. (1988))

Frequency rank 39030/72933
vadhukā noun (feminine) a young woman or wife (Monier-Williams, Sir M. (1988))

Frequency rank 25276/72933
vadhya noun (masculine) a criminal an enemy (Monier-Williams, Sir M. (1988))

Frequency rank 19984/72933
vadhyabhūmi noun (feminine) a place of public execution (Monier-Williams, Sir M. (1988))

Frequency rank 64539/72933
vadhyatā noun (feminine) fitness to be killed (Monier-Williams, Sir M. (1988))
the state of being sentenced to death (Monier-Williams, Sir M. (1988))

Frequency rank 19985/72933
vadhyā noun (feminine) killing (Monier-Williams, Sir M. (1988))
murder (Monier-Williams, Sir M. (1988))

Frequency rank 11067/72933
vadhū noun (feminine) (esp.) a cow or mare (Monier-Williams, Sir M. (1988))
a bride or newly-married woman (Monier-Williams, Sir M. (1988))
a daughter-in-law (Monier-Williams, Sir M. (1988))
any wife or woman (Monier-Williams, Sir M. (1988))
any younger female relation (Monier-Williams, Sir M. (1988))
Curcuma Zerumbet (Monier-Williams, Sir M. (1988))
Echites Frutescens (Monier-Williams, Sir M. (1988))
spouse (Monier-Williams, Sir M. (1988))
Trigonella Corniculata (Monier-Williams, Sir M. (1988))
the female of any animal (Monier-Williams, Sir M. (1988))
young wife (Monier-Williams, Sir M. (1988))

Frequency rank 2480/72933
vadhūkā noun (feminine) a bride
Frequency rank 39032/72933
vadhūsarā noun (feminine) name of a river; fabled to have sprung from the weeping eyes of Pulomā (Monier-Williams, Sir M. (1988))

Frequency rank 64541/72933
vadi indeclinable in the dark half of any month (affixed to the names of months in giving dates) (Monier-Williams, Sir M. (1988))

Frequency rank 64536/72933
vadānya adjective a munificent giver (Monier-Williams, Sir M. (1988))
affable (Monier-Williams, Sir M. (1988))
bountiful (Monier-Williams, Sir M. (1988))
eloquent (Monier-Williams, Sir M. (1988))
liberal (Monier-Williams, Sir M. (1988))
munificent (Monier-Williams, Sir M. (1988))
speaking kindly or agreeably (Monier-Williams, Sir M. (1988))

Frequency rank 7465/72933
agrevadha noun (masculine) hitting or killing whatever is in front (Monier-Williams, Sir M. (1988))
name of Śiva
Frequency rank 41744/72933
anavadāya indeclinable not having paid (one's debts)
Frequency rank 42771/72933
anavadyā noun (feminine) name of an Apsaras (Monier-Williams, Sir M. (1988))

Frequency rank 31773/72933
anavadya adjective faultless (Monier-Williams, Sir M. (1988))
unobjectionable (Monier-Williams, Sir M. (1988))

Frequency rank 5803/72933
anavadyāṅga adjective having faultless body or limbs (Monier-Williams, Sir M. (1988))

Frequency rank 9752/72933
anavadhi adjective unlimited (Monier-Williams, Sir M. (1988))

Frequency rank 42772/72933
anavadhāna noun (neuter) inadvertence (Monier-Williams, Sir M. (1988))
inattention (Monier-Williams, Sir M. (1988))

Frequency rank 26287/72933
anavadhāna adjective careless (Monier-Williams, Sir M. (1988))
inattentive (Monier-Williams, Sir M. (1988))

Frequency rank 42773/72933
anavadhānatā noun (feminine) inadvertency (Monier-Williams, Sir M. (1988))

Frequency rank 42774/72933
anavadhārin adjective
Frequency rank 42775/72933
anavadhāraṇa noun (neuter)
Frequency rank 31774/72933
anavadhārita adjective
Frequency rank 22932/72933
anavadhṛti noun (feminine)
Frequency rank 42776/72933
anavadhṛta adjective
Frequency rank 26288/72933
anavadheya adjective
Frequency rank 42777/72933
anahaṃvada adjective
Frequency rank 42808/72933
anirvadant adjective
Frequency rank 31861/72933
anuvad verb (class 1 parasmaipada) to imitate (Monier-Williams, Sir M. (1988))
to insist upon (Monier-Williams, Sir M. (1988))
to repeat the words of (Monier-Williams, Sir M. (1988))

Frequency rank 13937/72933
andhakavadhatadvarapradānavarṇana noun (neuter) name of SkPur, Revākhaṇḍa, 48
Frequency rank 43484/72933
anvadhisthā verb (class 1 ātmanepada)
Frequency rank 43534/72933
aparvadaṇḍa noun (masculine) a kind of sugar-cane (Monier-Williams, Sir M. (1988))

Frequency rank 43707/72933
apavad verb (class 1 ātmanepada) (in Gr.) to except (Monier-Williams, Sir M. (1988))
to abuse (Monier-Williams, Sir M. (1988))
to console by tales (Monier-Williams, Sir M. (1988))
to contradict (Monier-Williams, Sir M. (1988))
to deny (Monier-Williams, Sir M. (1988))
to disown (Monier-Williams, Sir M. (1988))
to distract (Monier-Williams, Sir M. (1988))
to divert (Monier-Williams, Sir M. (1988))
to revile (Monier-Williams, Sir M. (1988))

Frequency rank 16432/72933
apavadh verb (class 1 parasmaipada) to avert (Monier-Williams, Sir M. (1988))
to cut off (Monier-Williams, Sir M. (1988))
to repel (Monier-Williams, Sir M. (1988))
to split (Monier-Williams, Sir M. (1988))

Frequency rank 43711/72933
apriyaṃvada adjective speaking unkindly or harshly (Monier-Williams, Sir M. (1988))

Frequency rank 23094/72933
abhavadīya adjective not belonging to your Honour (Monier-Williams, Sir M. (1988))

Frequency rank 44086/72933
abhivad verb (class 1 ātmanepada) to accuse to address or salute with reverence (Monier-Williams, Sir M. (1988))
to call (Monier-Williams, Sir M. (1988))
to declare with reference to (Monier-Williams, Sir M. (1988))
to express by (Monier-Williams, Sir M. (1988))
to name (Monier-Williams, Sir M. (1988))
to present one's self to (dat.) (Monier-Williams, Sir M. (1988))
to say (Monier-Williams, Sir M. (1988))
to speak (Monier-Williams, Sir M. (1988))

Frequency rank 5967/72933
abhyavadhā verb (class 3 parasmaipada) to allay (Monier-Williams, Sir M. (1988))
to lay (as dust) (Monier-Williams, Sir M. (1988))

Frequency rank 44474/72933
avadant adjective not speaking (Monier-Williams, Sir M. (1988))

Frequency rank 32624/72933
avadaraṇa noun (neuter) breaking (as a boil etc.) (Monier-Williams, Sir M. (1988))
bursting (Monier-Williams, Sir M. (1988))
separating (Monier-Williams, Sir M. (1988))

Frequency rank 12813/72933
avadal verb (class 1 parasmaipada) to burst (Monier-Williams, Sir M. (1988))
to crack asunder (Monier-Williams, Sir M. (1988))

Frequency rank 45134/72933
avadah verb (class 1 parasmaipada) to burn down (Monier-Williams, Sir M. (1988))
to consume (Monier-Williams, Sir M. (1988))
to expel from (abl.) with heat or fire (Monier-Williams, Sir M. (1988))

Frequency rank 32625/72933
avadaṃśa noun (masculine) any pungent food (which excites thirst) (Monier-Williams, Sir M. (1988))
stimulant (Monier-Williams, Sir M. (1988))

Frequency rank 26689/72933
avadāta adjective blameless (Monier-Williams, Sir M. (1988))
clean (Monier-Williams, Sir M. (1988))
cleansed (Monier-Williams, Sir M. (1988))
clear (Monier-Williams, Sir M. (1988))
clear (Monier-Williams, Sir M. (1988))
dazzling white (Monier-Williams, Sir M. (1988))
excellent (Monier-Williams, Sir M. (1988))
intelligible (Monier-Williams, Sir M. (1988))
of white splendour (Monier-Williams, Sir M. (1988))
pure (Monier-Williams, Sir M. (1988))

Frequency rank 7271/72933
avadātatā noun (feminine)
Frequency rank 45135/72933
avadāna noun (neuter) a great or glorious act (Monier-Williams, Sir M. (1988))
achievement (object of a legend) (Monier-Williams, Sir M. (1988))

Frequency rank 26690/72933
avadāraṇa adjective breaking (Monier-Williams, Sir M. (1988))
shattering in pieces (Monier-Williams, Sir M. (1988))

Frequency rank 23212/72933
avadāraṇa noun (neuter) "opening (the ground)" (Monier-Williams, Sir M. (1988))
a spade or hoe (Monier-Williams, Sir M. (1988))
breaking (Monier-Williams, Sir M. (1988))
breaking open (Monier-Williams, Sir M. (1988))
bursting open (Monier-Williams, Sir M. (1988))
shattering (Monier-Williams, Sir M. (1988))

Frequency rank 26691/72933
avadāray verb (class 10 parasmaipada) to cause to burst (Monier-Williams, Sir M. (1988))
to rend or split (Monier-Williams, Sir M. (1988))

Frequency rank 20767/72933
avadāheṣṭa noun (neuter) the root of the fragrant grass Andropogon Muricatus (Monier-Williams, Sir M. (1988))

Frequency rank 45136/72933
avadīpay verb (class 10 ātmanepada)
Frequency rank 45137/72933
avadṛ verb (class 2 parasmaipada) to melt to rend or tear asunder (Monier-Williams, Sir M. (1988))
to split open (Monier-Williams, Sir M. (1988))

Frequency rank 12814/72933
avadohin adjective equipped with a milkpail giving milk
Frequency rank 32626/72933
avadoha noun (masculine) milk (Monier-Williams, Sir M. (1988))

Frequency rank 45138/72933
avadohay verb (class 10 parasmaipada) to pour over with milk (Monier-Williams, Sir M. (1988))

Frequency rank 32627/72933
avadya adjective blamable (Monier-Williams, Sir M. (1988))
disagreeable (Monier-Williams, Sir M. (1988))
inferior (Monier-Williams, Sir M. (1988))
low (Monier-Williams, Sir M. (1988))

Frequency rank 14697/72933
avadya noun (neuter) anything blamable (Monier-Williams, Sir M. (1988))
blame (Monier-Williams, Sir M. (1988))
censure (Monier-Williams, Sir M. (1988))
disgrace (Monier-Williams, Sir M. (1988))
imperfection (Monier-Williams, Sir M. (1988))
shame (Monier-Williams, Sir M. (1988))
vice (Monier-Williams, Sir M. (1988))
want (Monier-Williams, Sir M. (1988))

Frequency rank 26692/72933
avadyavant adjective disgraceful (Monier-Williams, Sir M. (1988))
lamentable (Monier-Williams, Sir M. (1988))

Frequency rank 45139/72933
avadyotana noun (neuter) illustrating (Monier-Williams, Sir M. (1988))

Frequency rank 45140/72933
avadhi noun (masculine) a hole (Monier-Williams, Sir M. (1988))
a term (Monier-Williams, Sir M. (1988))
attention (Monier-Williams, Sir M. (1988))
conclusion (Monier-Williams, Sir M. (1988))
environs (Monier-Williams, Sir M. (1988))
limit (Monier-Williams, Sir M. (1988))
neighbourhood (Monier-Williams, Sir M. (1988))
period (Monier-Williams, Sir M. (1988))
pit (Monier-Williams, Sir M. (1988))
surrounding district (Monier-Williams, Sir M. (1988))
termination (Monier-Williams, Sir M. (1988))
time (Monier-Williams, Sir M. (1988))

Frequency rank 5597/72933
avadha noun (masculine) absence of murder (Monier-Williams, Sir M. (1988))
the not striking or hurting (Monier-Williams, Sir M. (1988))

Frequency rank 12360/72933
avadhū verb (class 5 parasmaipada) to frighten away (Monier-Williams, Sir M. (1988))
to shake off (as enemies or evil spirits or anything disagreeable) (Monier-Williams, Sir M. (1988))
to shake off or out or down (Monier-Williams, Sir M. (1988))

Frequency rank 7272/72933
avadham verb (class 1 parasmaipada) to stir up (Monier-Williams, Sir M. (1988))

Frequency rank 32628/72933
avadhamay verb (class 10 parasmaipada)
Frequency rank 32629/72933
avadhā verb (class 3 ātmanepada) to deposit (Monier-Williams, Sir M. (1988))
to place down (Monier-Williams, Sir M. (1988))
to place or turn aside (Monier-Williams, Sir M. (1988))
to plunge into (Monier-Williams, Sir M. (1988))

Frequency rank 5899/72933
avadhātṛ adjective
Frequency rank 45141/72933
avadhāna noun (neuter) attention (Monier-Williams, Sir M. (1988))
attentiveness (Monier-Williams, Sir M. (1988))
intentness (Monier-Williams, Sir M. (1988))

Frequency rank 7064/72933
avadhānavant adjective attentive
Frequency rank 45142/72933
avadhārin adjective
Frequency rank 45143/72933
avadhāraka adjective bearing upon (Monier-Williams, Sir M. (1988))
determining (Monier-Williams, Sir M. (1988))
meaning (Monier-Williams, Sir M. (1988))
restricting (Monier-Williams, Sir M. (1988))

Frequency rank 45144/72933
avadhāraṇa noun (neuter) accurate determination (Monier-Williams, Sir M. (1988))
affirmation (Monier-Williams, Sir M. (1988))
ascertainment (Monier-Williams, Sir M. (1988))
emphasis (Monier-Williams, Sir M. (1988))
limitation (of the sense of words) (Monier-Williams, Sir M. (1988))
restriction to a certain instance or instances with exclusion of any other (Monier-Williams, Sir M. (1988))
stating or holding with positiveness or assurance (Monier-Williams, Sir M. (1988))

Frequency rank 6039/72933
avadhāraṇatā noun (feminine)
Frequency rank 45145/72933
avadhāray verb (class 10 ātmanepada) to ascertain (Monier-Williams, Sir M. (1988))
to become acquainted with (Monier-Williams, Sir M. (1988))
to communicate (Monier-Williams, Sir M. (1988))
to conceive (Monier-Williams, Sir M. (1988))
to consider (Monier-Williams, Sir M. (1988))
to determine accurately (Monier-Williams, Sir M. (1988))
to hear (Monier-Williams, Sir M. (1988))
to learn (Monier-Williams, Sir M. (1988))
to limit (Monier-Williams, Sir M. (1988))
to make out (Monier-Williams, Sir M. (1988))
to reflect upon (Monier-Williams, Sir M. (1988))
to restrict (Monier-Williams, Sir M. (1988))
to think of (acc. or a phrase with iti) (Monier-Williams, Sir M. (1988))
to understand (Monier-Williams, Sir M. (1988))

Frequency rank 4413/72933
avadhārya adjective "to be made out or understood" (Monier-Williams, Sir M. (1988))
to be ascertained or known (Monier-Williams, Sir M. (1988))

Frequency rank 45146/72933
avadhi indeclinable bis hin zu ...
Frequency rank 2577/72933
avadhimant adjective bounded (Monier-Williams, Sir M. (1988))
limited (Monier-Williams, Sir M. (1988))

Frequency rank 45147/72933
avadhīrin adjective despising (Monier-Williams, Sir M. (1988))
excelling (Monier-Williams, Sir M. (1988))

Frequency rank 45148/72933
avadhīraṇā noun (feminine) repudiating (Monier-Williams, Sir M. (1988))
treating with disrespect (Monier-Williams, Sir M. (1988))

Frequency rank 45149/72933
avadhīray verb (denominative parasmaipada) to disregard
Frequency rank 32630/72933
avadhīrita adjective disregarded (Monier-Williams, Sir M. (1988))
disrespected (Monier-Williams, Sir M. (1988))
excelled (Monier-Williams, Sir M. (1988))
surpassed (Monier-Williams, Sir M. (1988))

Frequency rank 18912/72933
avadhṛ verb (class 1 ātmanepada)
Frequency rank 26693/72933
avadhūtā noun (feminine) eine der fünf caryās
Frequency rank 45150/72933
avadhūta noun (masculine) name of a Śaiva philosopher (Monier-Williams, Sir M. (1988))

Frequency rank 23213/72933
avadhūta adjective agitated (especially as plants or the dust by the wind) (Monier-Williams, Sir M. (1988))
discarded (Monier-Williams, Sir M. (1988))
disregarded (Monier-Williams, Sir M. (1988))
excluded (Monier-Williams, Sir M. (1988))
expelled (Monier-Williams, Sir M. (1988))
fanned (Monier-Williams, Sir M. (1988))
neglected (Monier-Williams, Sir M. (1988))
off from himself worldly feeling and obligation (Monier-Williams, Sir M. (1988))
one who has shaken (Monier-Williams, Sir M. (1988))
rejected (Monier-Williams, Sir M. (1988))
removed (Monier-Williams, Sir M. (1988))
shaken (Monier-Williams, Sir M. (1988))
shaken away (Monier-Williams, Sir M. (1988))
shaken off (as evil spirits) (Monier-Williams, Sir M. (1988))
that upon which anything unclean has been shaken out or off (Monier-Williams, Sir M. (1988))
touched (Monier-Williams, Sir M. (1988))
unclean (Monier-Williams, Sir M. (1988))

Frequency rank 32631/72933
avadhūnana noun (neuter) agitation (Monier-Williams, Sir M. (1988))
causing to shake (Monier-Williams, Sir M. (1988))
shaking (Monier-Williams, Sir M. (1988))
shaking (of the earth) (Monier-Williams, Sir M. (1988))

Frequency rank 26694/72933
avadhūnay verb (class 10 parasmaipada) to shake
Frequency rank 26695/72933
avadhya adjective inviolable (Monier-Williams, Sir M. (1988))
not to be killed (Monier-Williams, Sir M. (1988))

Frequency rank 2662/72933
avadhyatā noun (feminine) inviolability (Monier-Williams, Sir M. (1988))

Frequency rank 23214/72933
avadhyamāna adjective unkillable
Frequency rank 32632/72933
avadhyā verb (class 4 parasmaipada) to disregard (Monier-Williams, Sir M. (1988))
to think ill of (acc.) (Monier-Williams, Sir M. (1988))

Frequency rank 23215/72933
avivadamāna adjective not quarelling
Frequency rank 45452/72933
avyavadāna noun (neuter)
Frequency rank 45551/72933
avyavadhāna noun (neuter) contiguity (Monier-Williams, Sir M. (1988))
non-interruption (Monier-Williams, Sir M. (1988))
non-separation (Monier-Williams, Sir M. (1988))

Frequency rank 17618/72933
aśvadaṃṣṭrā noun (feminine) the plant Tribulus Lanuginosus (Monier-Williams, Sir M. (1988))

Frequency rank 23284/72933
asvadharma noun (masculine) neglect of one's duty (Monier-Williams, Sir M. (1988))

Frequency rank 46062/72933
ātmavadha noun (masculine) suicide (Monier-Williams, Sir M. (1988))

Frequency rank 26921/72933
ātmavadhyā noun (feminine) suicide (Monier-Williams, Sir M. (1988))

Frequency rank 46332/72933
āragvadha noun (masculine) Cassia fistula Linn. (Monier-Williams, Sir M. (1988))
Cathartocarpus fistula Pers.
Frequency rank 4312/72933
āragvadha noun (neuter) the fruit of Carthartocarpus Fistula (Monier-Williams, Sir M. (1988))

Frequency rank 46585/72933
āragvadhagaṇa noun (masculine) āragvadhādi
Frequency rank 46586/72933
āragvadhādi noun (masculine) [medic.] name of a pharmaceutical gaṇa/varga
Frequency rank 7654/72933
āragvadhādika noun (masculine) [medic.] āragvadhādi
Frequency rank 46587/72933
āragvadhādya noun (masculine) āragvadhādi
Frequency rank 46588/72933
āragvadhīya noun (masculine) name of Carakasaṃhitā, Sū. 3
Frequency rank 33148/72933
āsavadru noun (masculine) name of the Palmyra tree Borassus Flabelliformis (Monier-Williams, Sir M. (1988))

Frequency rank 46798/72933
āsvad verb (class 1 parasmaipada) to consume (Monier-Williams, Sir M. (1988))
to eat (Monier-Williams, Sir M. (1988))

Frequency rank 33228/72933
indravadhū noun (feminine) a kind of insect
Frequency rank 46937/72933
upavad verb (class 1 parasmaipada) to abuse (Monier-Williams, Sir M. (1988))
to address (Monier-Williams, Sir M. (1988))
to cajole (Monier-Williams, Sir M. (1988))
to court secretly (Monier-Williams, Sir M. (1988))
to curse (Monier-Williams, Sir M. (1988))
to decry (Monier-Williams, Sir M. (1988))
to flatter (Monier-Williams, Sir M. (1988))
to speak ill of (Monier-Williams, Sir M. (1988))
to speak to (Monier-Williams, Sir M. (1988))

Frequency rank 47627/72933
ekavadana noun (masculine) a kind of plant
Frequency rank 47990/72933
aurdhvadeha adjective relating or referring to the state after death (Monier-Williams, Sir M. (1988))
relating to future life (Monier-Williams, Sir M. (1988))

Frequency rank 48209/72933
aurdhvadehika noun (neuter) obsequies of a deceased person (Monier-Williams, Sir M. (1988))
whatever is offered or performed on a person's decease (as burning of the body, offering cakes, distributing alms etc.) (Monier-Williams, Sir M. (1988))

Frequency rank 14079/72933
aurdhvadehika adjective funeral (Monier-Williams, Sir M. (1988))
funereal (Monier-Williams, Sir M. (1988))
performed in honour of the dead (Monier-Williams, Sir M. (1988))
relating to a deceased person (Monier-Williams, Sir M. (1988))
relating to the life after death (Monier-Williams, Sir M. (1988))

Frequency rank 23579/72933
aurdhvadaihika adjective leading to a higher existence
Frequency rank 19100/72933
kiṃvadantī noun (feminine)
Frequency rank 49486/72933
kulavadhū noun (feminine) a virtuous wife (Monier-Williams, Sir M. (1988))
respectable woman (Monier-Williams, Sir M. (1988))

Frequency rank 34157/72933
kṣārapūrvadaśaka noun (neuter) a decade of acrid substances (Monier-Williams, Sir M. (1988))

Frequency rank 50539/72933
gandharvadattā noun (feminine) name of a daughter of the Gandharva prince Sāgaradatta (Monier-Williams, Sir M. (1988))

Frequency rank 6874/72933
gandhavadhū noun (feminine) a kind of perfume (Monier-Williams, Sir M. (1988))
Curcuma zerumbet (Monier-Williams, Sir M. (1988))

Frequency rank 23860/72933
gāṇḍīvadhanvan noun (masculine) Arjuna (Monier-Williams, Sir M. (1988))

Frequency rank 5032/72933
jalandharavadha noun (masculine) name of Liṅgapurāṇa, 1.97
Frequency rank 52768/72933
jīvadā noun (feminine) Name einer Pflanze
Frequency rank 52989/72933
jīvada noun (masculine) an enemy (Monier-Williams, Sir M. (1988))
Name einer Pflanze
Frequency rank 52990/72933
jīvadātrī noun (feminine) Coelogyne ovalis or Hoya viridiflora (Monier-Williams, Sir M. (1988))

Frequency rank 35197/72933
jīvadvatsā noun (feminine)
Frequency rank 52991/72933
jīvadhānī noun (feminine) the earth (Monier-Williams, Sir M. (1988))

Frequency rank 52992/72933
tattvadarśin noun (masculine) name of a man
Frequency rank 28147/72933
tāvaddhā indeclinable in such a number (Monier-Williams, Sir M. (1988))
in that number (Monier-Williams, Sir M. (1988))

Frequency rank 53507/72933
turaṃgavadana noun (masculine) a Kiṃpuruṣa
Frequency rank 53692/72933
tvad pronoun you
Frequency rank 14/72933
tvadīya adjective thine (Monier-Williams, Sir M. (1988))
thy (Monier-Williams, Sir M. (1988))
your (Monier-Williams, Sir M. (1988))
yours (Monier-Williams, Sir M. (1988))

Frequency rank 4466/72933
tvadvidha adjective like thee (Monier-Williams, Sir M. (1988))

Frequency rank 6226/72933
davadagdhaka noun (neuter) a species of grass
Frequency rank 54278/72933
devadaṇḍā noun (feminine) Uraria lagopodioides
Frequency rank 54929/72933
devadaṇḍaka noun (neuter) kattṛṇa
Frequency rank 54930/72933
devadatta noun (masculine) a common name for men used in grammar, phil. etc. (Monier-Williams, Sir M. (1988))
name of Arjuna's conch-shell (Monier-Williams, Sir M. (1988))
name of a cousin (or younger brother) and opponent of Gautama Buddha (Monier-Williams, Sir M. (1988))
name of a Grāma of the Bāhikas (Monier-Williams, Sir M. (1988))
name of a Nāga (Monier-Williams, Sir M. (1988))
name of a son of Haridatta (Monier-Williams, Sir M. (1988))
name of a son of king Jayadatta (Monier-Williams, Sir M. (1988))
name of a son of the Brāhman Govindadatta (Monier-Williams, Sir M. (1988))
name of a son of Uruśravas and father of agniveśya (Monier-Williams, Sir M. (1988))
name of one of the vital airs (which is exhaled in yawning) (Monier-Williams, Sir M. (1988))
name of several authors (Monier-Williams, Sir M. (1988))

Frequency rank 5498/72933
devadattā noun (feminine) name of a courtesan (Monier-Williams, Sir M. (1988))
name of the mother of Devadatta who was the cousin of Gautama Buddha (Monier-Williams, Sir M. (1988))

Frequency rank 54931/72933
devadarśana noun (masculine) name of a Brāhman (Monier-Williams, Sir M. (1988))
name of Nārada (Monier-Williams, Sir M. (1988))

Frequency rank 54932/72933
devadāru noun (masculine neuter) Pinus Devadāru or Deodar (Monier-Williams, Sir M. (1988))

Frequency rank 2704/72933
devadāruka noun (masculine) Pinus Devadāru
Frequency rank 35824/72933
devadāli noun (feminine)
Frequency rank 24258/72933
devadālī noun (feminine) Andropogon caricosus Linn. Andropogon serratus Retz. a kind of pumpkin (Monier-Williams, Sir M. (1988))
Lepeocercis serrata Trin. Luffa echinata Roxb.
Frequency rank 2871/72933
devadālikā noun (feminine neuter) a kind of pumpkin (Monier-Williams, Sir M. (1988))

Frequency rank 14204/72933
devadāsī noun (feminine) a temple Nāch-girl (Monier-Williams, Sir M. (1988))
the wild citron tree (Monier-Williams, Sir M. (1988))

Frequency rank 54933/72933
devadundubhi noun (masculine) holy basil with red flowers (Monier-Williams, Sir M. (1988))
name of Indra (Monier-Williams, Sir M. (1988))

Frequency rank 35825/72933
devadevī noun (feminine) name of Durgā (Monier-Williams, Sir M. (1988))

Frequency rank 28440/72933
devadeva noun (masculine) Brahmā and Śiva (Monier-Williams, Sir M. (1988))
name of Brahmā (Monier-Williams, Sir M. (1988))
name of Gaṇeśa (Monier-Williams, Sir M. (1988))
name of Indra name of Rudra-Śiva (Monier-Williams, Sir M. (1988))
name of Sūrya name of Viṣṇu-Kṛṣṇa (Monier-Williams, Sir M. (1988))
the Brāhmans (Monier-Williams, Sir M. (1988))

Frequency rank 964/72933
devadeveśa noun (masculine) name of Indra name of Viṣṇu name of Śiva [rel.] name of Brahmā
Frequency rank 3251/72933
devadeveśī noun (feminine) Devī
Frequency rank 11285/72933
devadūtī noun (feminine) the wild citron tree (Monier-Williams, Sir M. (1988))

Frequency rank 35826/72933
devadyota noun (masculine) name of a son of Upamadgu
Frequency rank 54934/72933
devadroṇī noun (feminine) an idol procession (orig. ablution) (Monier-Williams, Sir M. (1988))
Phlomis Ceylanica (Monier-Williams, Sir M. (1988))

Frequency rank 28441/72933
devadhānya noun (neuter) Andropogon Saccharatus (Monier-Williams, Sir M. (1988))
Andropogon Sorgum (Monier-Williams, Sir M. (1988))
Holcus Sorgum (Monier-Williams, Sir M. (1988))
Sorghum vulgare Pers. (G.J. Meulenbeld (1974), 563) Sorgum Cernuum Zea mays Linn. (G.J. Meulenbeld (1974), 563)
Frequency rank 35827/72933
devadhūpa noun (masculine) bdellium Shorea Robusta
Frequency rank 21488/72933
dravadravyavijñānīya noun (masculine) name of Aṣṭāṅgahṛdayasaṃhitā, Sū. 5
Frequency rank 55102/72933
dravadravyavidhi noun (masculine) name of Suśrutasaṃhitā, Sū. 45
Frequency rank 55103/72933
dūrevadha adjective far-striking (Monier-Williams, Sir M. (1988))

Frequency rank 55158/72933
dhūrtavadhū noun (feminine) a kind of plant
Frequency rank 55548/72933
navadala noun (neuter) the fresh leaf of a lotus or any young leaf (Monier-Williams, Sir M. (1988))

Frequency rank 55747/72933
navadaśa adjective consisting of 19 (Monier-Williams, Sir M. (1988))
the 19th (Monier-Williams, Sir M. (1988))

Frequency rank 28585/72933
navadaśan adjective 19 (Monier-Williams, Sir M. (1988))

Frequency rank 55748/72933
navadru noun (masculine) Buchanania latifolia
Frequency rank 55749/72933
navadvīpa noun (masculine) name of a place now called Nuddea (at the confluence of the Bhāgīrathī and the Jalangī rivers) (Monier-Williams, Sir M. (1988))

Frequency rank 55750/72933
navadhā indeclinable 9 times (Monier-Williams, Sir M. (1988))
in 9 ways (Monier-Williams, Sir M. (1988))
into 9 parts (Monier-Williams, Sir M. (1988))

Frequency rank 7198/72933
navadhānyādi noun (masculine) name of a pharmacological varga
Frequency rank 28586/72933
navadhānyādika noun (masculine) navadhānyādi
Frequency rank 55751/72933
niravadya adjective unblamable (Monier-Williams, Sir M. (1988))

Frequency rank 13592/72933
niravadhi adjective endless (Monier-Williams, Sir M. (1988))
infinite (Monier-Williams, Sir M. (1988))
unlimited (Monier-Williams, Sir M. (1988))

Frequency rank 21581/72933
nirvad verb (class 1 ātmanepada) to abuse (Monier-Williams, Sir M. (1988))
to deny (Monier-Williams, Sir M. (1988))
to expel or drive away (Monier-Williams, Sir M. (1988))
to order off (Monier-Williams, Sir M. (1988))
to revile (Monier-Williams, Sir M. (1988))
to speak out (Monier-Williams, Sir M. (1988))
to utter (Monier-Williams, Sir M. (1988))
to warn off (Monier-Williams, Sir M. (1988))

Frequency rank 19525/72933
nivadh verb (class 1 parasmaipada) to fix in (Monier-Williams, Sir M. (1988))
to hurl down upon (Monier-Williams, Sir M. (1988))
to kill (Monier-Williams, Sir M. (1988))
to strike down (Monier-Williams, Sir M. (1988))

Frequency rank 14246/72933
niḥsvadha adjective
Frequency rank 56593/72933
niḥsvadhākāra adjective not pronouncing the svadhā
Frequency rank 36458/72933
pakṣavadha noun (masculine) a paralysis of one side (Monier-Williams, Sir M. (1988))
Hemiplegie
Frequency rank 21630/72933
paraśvadha noun (masculine) a hatchet (Monier-Williams, Sir M. (1988))
axe (Monier-Williams, Sir M. (1988))

Frequency rank 3916/72933
paraśvadhin adjective furnished with an axe (Monier-Williams, Sir M. (1988))

Frequency rank 28856/72933
paraśvadhāyudha noun (masculine) name of Śiva
Frequency rank 57163/72933
parivad verb (class 1 ātmanepada) to accuse (Monier-Williams, Sir M. (1988))
to revile (Monier-Williams, Sir M. (1988))
to slander (Monier-Williams, Sir M. (1988))
to speak ill of (Monier-Williams, Sir M. (1988))
to speak of or about (acc.) (Monier-Williams, Sir M. (1988))
to speak out (Monier-Williams, Sir M. (1988))

Frequency rank 16946/72933
paryavadāta adjective perfectly clean or pure (Monier-Williams, Sir M. (1988))
very accomplished (Monier-Williams, Sir M. (1988))
very familiar (Monier-Williams, Sir M. (1988))
well known (Monier-Williams, Sir M. (1988))

Frequency rank 24559/72933
pallavadru noun (masculine) the Aśoka tree (Monier-Williams, Sir M. (1988))

Frequency rank 57589/72933
puravadhū noun (feminine)
Frequency rank 36983/72933
paurvadehika adjective belonging to or derived from a former body or a (Monier-Williams, Sir M. (1988))
done in a former life (Monier-Williams, Sir M. (1988))
former existence (Monier-Williams, Sir M. (1988))

Frequency rank 18165/72933
paurvadaihika adjective belonging to or derived from a former body (Monier-Williams, Sir M. (1988))
done in a former life (Monier-Williams, Sir M. (1988))

Frequency rank 37064/72933
prativad verb (class 1 ātmanepada) to answer (Monier-Williams, Sir M. (1988))
to repeat (Monier-Williams, Sir M. (1988))
to reply to (acc.) (Monier-Williams, Sir M. (1988))
to speak back (Monier-Williams, Sir M. (1988))
to speak to (acc) (Monier-Williams, Sir M. (1988))

Frequency rank 37200/72933
prativadh verb (class 1 parasmaipada) to beat back (Monier-Williams, Sir M. (1988))

Frequency rank 58910/72933
pratyabhivad verb (class 1 ātmanepada) to greet in return (Monier-Williams, Sir M. (1988))
to return a salute (Monier-Williams, Sir M. (1988))

Frequency rank 59068/72933
pravada adjective sounding (as a drum) (Monier-Williams, Sir M. (1988))
sounding forth (Monier-Williams, Sir M. (1988))

Frequency rank 59363/72933
pravada noun (masculine) a herald (Monier-Williams, Sir M. (1988))
bard (?) (Monier-Williams, Sir M. (1988))

Frequency rank 29238/72933
pravad verb (class 1 ātmanepada) to affirm (Monier-Williams, Sir M. (1988))
to assert (Monier-Williams, Sir M. (1988))
to call (Monier-Williams, Sir M. (1988))
to declare (Monier-Williams, Sir M. (1988))
to name (2 acc.) (Monier-Williams, Sir M. (1988))
to offer for sale (with instr. of price) (Monier-Williams, Sir M. (1988))
to proclaim (Monier-Williams, Sir M. (1988))
to pronounce (Monier-Williams, Sir M. (1988))
to pronounce to be (Monier-Williams, Sir M. (1988))
to raise the voice (said of birds and animals) (Monier-Williams, Sir M. (1988))
to roar (Monier-Williams, Sir M. (1988))
to say (Monier-Williams, Sir M. (1988))
to speak out (Monier-Williams, Sir M. (1988))
to speak to (acc.) (Monier-Williams, Sir M. (1988))
to splash (said of water) (Monier-Williams, Sir M. (1988))
to state (Monier-Williams, Sir M. (1988))
to tell (Monier-Williams, Sir M. (1988))
to utter (Monier-Williams, Sir M. (1988))

Frequency rank 3131/72933
pravaditṛ adjective one who speaks out (Monier-Williams, Sir M. (1988))
uttering (gen. or acc.) (Monier-Williams, Sir M. (1988))

Frequency rank 59364/72933
priyaṃvada adjective affable to (gen. or comp.) (Monier-Williams, Sir M. (1988))
agreeable (Monier-Williams, Sir M. (1988))
speaking kindly (Monier-Williams, Sir M. (1988))

Frequency rank 6915/72933
priyaṃvadā noun (feminine) a kind of metre (Monier-Williams, Sir M. (1988))
name of a woman (Monier-Williams, Sir M. (1988))
name of Parvati
Frequency rank 21884/72933
pūrvadakṣiṇa adjective south-eastern (Monier-Williams, Sir M. (1988))

Frequency rank 59803/72933
pūrvadṛṣṭa adjective appeared in former times (Monier-Williams, Sir M. (1988))
declared by the ancients (Monier-Williams, Sir M. (1988))
primaeval (Monier-Williams, Sir M. (1988))
seen before (Monier-Williams, Sir M. (1988))

Frequency rank 59804/72933
pūrvadeva noun (masculine) a primaeval deity (Monier-Williams, Sir M. (1988))
an Asura or demon (offspring of Kaśyapa) (Monier-Williams, Sir M. (1988))

Frequency rank 11369/72933
plavadalā noun (feminine) a kind of plant (?)
Frequency rank 59831/72933
bakavadha noun (masculine)
Frequency rank 59947/72933
bilvadaṇḍa noun (masculine) name of Śiva (Monier-Williams, Sir M. (1988))

Frequency rank 60268/72933
bhagavadgītā noun (feminine) name of a celebrated mystical poem (Monier-Williams, Sir M. (1988))

Frequency rank 29437/72933
bhagavaddṛśa adjective resembling the Supreme (Monier-Williams, Sir M. (1988))

Frequency rank 37745/72933
bhagavadvākya noun (neuter) name of a text
Frequency rank 60491/72933
bhavadāru noun (neuter) Pinus Deodora
Frequency rank 60595/72933
bhavadīya adjective your (Monier-Williams, Sir M. (1988))
your honour's (Monier-Williams, Sir M. (1988))

Frequency rank 19767/72933
bhavadvasu adjective having wealth present (Monier-Williams, Sir M. (1988))
opulent (Monier-Williams, Sir M. (1988))
wealthy (Monier-Williams, Sir M. (1988))

Frequency rank 60596/72933
bhavadvidha adjective any one like your honour or like you (Monier-Williams, Sir M. (1988))

Frequency rank 12600/72933
mātṛvadha noun (masculine) the murder of a mother (with Buddhists one of the 5 unpardonable sins) (Monier-Williams, Sir M. (1988))

Frequency rank 62020/72933
mādhavadruma noun (masculine) Spondias Mangifera (Monier-Williams, Sir M. (1988))
the mango tree
Frequency rank 62039/72933
mlecchavadana noun (neuter) mlecchamukha
Frequency rank 62752/72933
yavadvīpa noun (masculine) the island Yava (Monier-Williams, Sir M. (1988))

Frequency rank 38515/72933
yāvadantam indeclinable as far as the end (Monier-Williams, Sir M. (1988))
to the last (Monier-Williams, Sir M. (1988))

Frequency rank 38541/72933
yāvadartha adjective as many as necessary (Monier-Williams, Sir M. (1988))
as much as is necessary (Monier-Williams, Sir M. (1988))
corresponding to requirement (Monier-Williams, Sir M. (1988))
devoted to anything (Monier-Williams, Sir M. (1988))

Frequency rank 13709/72933
yāvadābhūtasamplavam indeclinable to the end of the world (Monier-Williams, Sir M. (1988))
up to the dissolution of created things (Monier-Williams, Sir M. (1988))

Frequency rank 18358/72933
yāvadāyuṣam indeclinable as long as life lasts (Monier-Williams, Sir M. (1988))
for the whole of life (Monier-Williams, Sir M. (1988))

Frequency rank 63032/72933
yāvadāyus indeclinable for the whole of life (Monier-Williams, Sir M. (1988))

Frequency rank 38542/72933
yāvadiccham indeclinable according to desire (Monier-Williams, Sir M. (1988))

Frequency rank 29811/72933
yāvadgamam indeclinable as fast as one can go (Monier-Williams, Sir M. (1988))

Frequency rank 63033/72933
yāvaddeya adjective (in law) until paying a debt (Monier-Williams, Sir M. (1988))

Frequency rank 63034/72933
yāvaddravyabhāvin adjective (medic.) existing as long as the dravya exists
Frequency rank 38543/72933
ūrdhvadṛś noun (masculine) a crab (Monier-Williams, Sir M. (1988))

Frequency rank 63925/72933
vaśaṃvada adjective (mostly ifc.) submissive to the will of another (Monier-Williams, Sir M. (1988))
actuated or transported or overcome with (Monier-Williams, Sir M. (1988))
compliant (Monier-Williams, Sir M. (1988))
devoted or addicted to (Monier-Williams, Sir M. (1988))
obedient (Monier-Williams, Sir M. (1988))

Frequency rank 17191/72933
vahnivadhū noun (feminine) the wife of Agni (Svāhā) (Monier-Williams, Sir M. (1988))

Frequency rank 39150/72933
vāvadūka adjective disputatious (Monier-Williams, Sir M. (1988))
eloquent (Monier-Williams, Sir M. (1988))
garrulous (Monier-Williams, Sir M. (1988))
talking much (Monier-Williams, Sir M. (1988))

Frequency rank 65272/72933
vāsavadattā noun (feminine) name of various women (esp. of the wife of Udayana) (Monier-Williams, Sir M. (1988))

Frequency rank 15191/72933
vivad verb (class 1 ātmanepada) to be at variance to contest to contradict to converse to dispute with (instr) to litigate to oppose (acc.) to raise the voice to sing (said of birds) to talk
Frequency rank 5633/72933
vivadha noun (masculine) a ewer (Monier-Williams, Sir M. (1988))
a particular Ekāha (Monier-Williams, Sir M. (1988))
a road (Monier-Williams, Sir M. (1988))
a shoulder-yoke for carrying burdens (Monier-Williams, Sir M. (1988))
a store of grain or hay (Monier-Williams, Sir M. (1988))
pitcher (Monier-Williams, Sir M. (1988))
provisions (Monier-Williams, Sir M. (1988))
the income which a king obtains from his subjects (Monier-Williams, Sir M. (1988))

Frequency rank 66043/72933
viśvadaṃṣṭra noun (masculine) name of an Asura (Monier-Williams, Sir M. (1988))

Frequency rank 66143/72933
viśvadeva noun (masculine) a particular class of deities (Monier-Williams, Sir M. (1988))
name of a god (Monier-Williams, Sir M. (1988))
name of a teacher (Monier-Williams, Sir M. (1988))
name of Śiva the Viśve Devāḥ (Monier-Williams, Sir M. (1988))

Frequency rank 22289/72933
viśvadevā noun (feminine) a species of red-flowering Daṇḍotpala (Monier-Williams, Sir M. (1988))
Hedysarum Lagopedioides (Monier-Williams, Sir M. (1988))
Uraria lagopodioides (Monier-Williams, Sir M. (1988))

Frequency rank 22290/72933
viśvadevya adjective distinguished by all divine attributes (Monier-Williams, Sir M. (1988))
relating or sacred or dear etc. to all gods (Monier-Williams, Sir M. (1988))

Frequency rank 66144/72933
viśvadhara noun (masculine) name of a man (Monier-Williams, Sir M. (1988))
name of Viṣṇu (Monier-Williams, Sir M. (1988))

Frequency rank 39534/72933
viśvadhārin noun (masculine) a deity (Monier-Williams, Sir M. (1988))

Frequency rank 66145/72933
viśvadhṛk adjective sustaining everything (Monier-Williams, Sir M. (1988))

Frequency rank 39535/72933
visaṃvad verb (class 1 ātmanepada) to break one's word or promise to contradict to fail in an agreement to raise objections
Frequency rank 30310/72933
vīvadha noun (masculine)
Frequency rank 66384/72933
vedavadana noun (neuter) grammar (Monier-Williams, Sir M. (1988))
introduction to the Veda (Monier-Williams, Sir M. (1988))
name of a place (Monier-Williams, Sir M. (1988))

Frequency rank 39687/72933
vaivadhika noun (masculine) a carrier (Monier-Williams, Sir M. (1988))
burden-bearer (Monier-Williams, Sir M. (1988))
hawker who carries wares to sell (Monier-Williams, Sir M. (1988))

Frequency rank 66739/72933
vaiśvadeva noun (neuter) name of a particular religious ceremony which ought to be performed morning and evening and especially before the midday meal (Monier-Williams, Sir M. (1988))
name of particular verses or formulas (Monier-Williams, Sir M. (1988))
name of various Sāmans (Monier-Williams, Sir M. (1988))
the first Parvan of the Cāturmāsya (Monier-Williams, Sir M. (1988))
the Nakṣatra Uttarāshāḍhā (Monier-Williams, Sir M. (1988))

Frequency rank 11804/72933
vaiśvadevī noun (feminine) a kind of metre (Monier-Williams, Sir M. (1988))
name of particular sacrificial bricks (Monier-Williams, Sir M. (1988))
the 8th day of the 2nd half of the month Māgha (Monier-Williams, Sir M. (1988))

Frequency rank 39740/72933
vaiśvadeva noun (masculine) a particular Ekāha (Monier-Williams, Sir M. (1988))
a particular Graha or Soma-vessel (Monier-Williams, Sir M. (1988))

Frequency rank 17264/72933
vaiśvadeva adjective relating or sacred to all the gods or to the Viśve Devāḥ (Monier-Williams, Sir M. (1988))

Frequency rank 22332/72933
vaiśvadevika adjective belonging to the Vaiśvadeva Parvan (Monier-Williams, Sir M. (1988))
corresponding to the deities ceremony (Monier-Williams, Sir M. (1988))
name of particular texts (Monier-Williams, Sir M. (1988))
relating or sacred to the Viśve Devāh (Monier-Williams, Sir M. (1988))

Frequency rank 39741/72933
vaiśvadaivatya noun (neuter)
Frequency rank 39742/72933
vyavadāna noun (neuter) purification (Monier-Williams, Sir M. (1988))

Frequency rank 22339/72933
vyavadṛ verb (class 4 parasmaipada) to break to burst
Frequency rank 66852/72933
vyavadhā noun (feminine) covering or anything that covers (Monier-Williams, Sir M. (1988))

Frequency rank 66853/72933
vyavadhū verb (class 5 parasmaipada) to reject to remove to repel to shake about to shake off to treat roughly or rudely to ward off
Frequency rank 39781/72933
vyavadhā verb (class 3 ātmanepada) to divide to interpose to interrupt to leave out to omit to place apart or asunder to put or place between to separate
Frequency rank 8693/72933
vyavadhāna noun (neuter) a cover (Monier-Williams, Sir M. (1988))
cessation (Monier-Williams, Sir M. (1988))
covering (Monier-Williams, Sir M. (1988))
division (Monier-Williams, Sir M. (1988))
hiding from view (Monier-Williams, Sir M. (1988))
interruption (Monier-Williams, Sir M. (1988))
interval (Monier-Williams, Sir M. (1988))
intervening (Monier-Williams, Sir M. (1988))
obstruction (Monier-Williams, Sir M. (1988))
screen (Monier-Williams, Sir M. (1988))
separation (Monier-Williams, Sir M. (1988))
space (Monier-Williams, Sir M. (1988))
termination (Monier-Williams, Sir M. (1988))

Frequency rank 14473/72933
vyavadhānavant adjective having a cover
Frequency rank 66854/72933
vyavadhāyaka adjective concealing (Monier-Williams, Sir M. (1988))
disturbing (Monier-Williams, Sir M. (1988))
hiding (Monier-Williams, Sir M. (1988))
interposing (Monier-Williams, Sir M. (1988))
interrupting (Monier-Williams, Sir M. (1988))
intervening (Monier-Williams, Sir M. (1988))
screening (Monier-Williams, Sir M. (1988))
separating (Monier-Williams, Sir M. (1988))

Frequency rank 66855/72933
vyavadhāv verb (class 1 ātmanepada) to run away
Frequency rank 39782/72933
vyavadhūnay verb (class 10 parasmaipada)
Frequency rank 66856/72933
vyavavad verb (class 1 ātmanepada) to begin to speak to break silence to speak ill of
Frequency rank 39783/72933
śivadāru noun (neuter) the tree Pinus Deodora (Monier-Williams, Sir M. (1988))

Frequency rank 67670/72933
śivadṛṣṭi noun (feminine) name of a work. (containing the Śaiva system) (Monier-Williams, Sir M. (1988))

Frequency rank 67671/72933
śivadūtī noun (feminine) name of a form of Durgā (Monier-Williams, Sir M. (1988))
name of a Yoginī (Monier-Williams, Sir M. (1988))

Frequency rank 67672/72933
śivadruma noun (masculine) Aegle Marmelos (Monier-Williams, Sir M. (1988))

Frequency rank 67673/72933
śivadviṣṭā noun (feminine) Pandanus Odoratissimus (Monier-Williams, Sir M. (1988))

Frequency rank 67674/72933
śivadharma noun (neuter) name of a chapter of the Nandikeśvarasaṃhitā (Monier-Williams, Sir M. (1988))

Frequency rank 67675/72933
śivadhāra noun (masculine neuter) name of a Tirtha (Monier-Williams, Sir M. (1988))

Frequency rank 67676/72933
śivadhūpa noun (masculine) a kind of plant
Frequency rank 67677/72933
śevadhi noun (masculine neuter) an inexhaustible quantity (of good or evil) (Monier-Williams, Sir M. (1988))
jewel (Monier-Williams, Sir M. (1988))
one of the nine treasures of Kubera (Monier-Williams, Sir M. (1988))
treasure (Monier-Williams, Sir M. (1988))
treasury (Monier-Williams, Sir M. (1988))
wealth (Monier-Williams, Sir M. (1988))

Frequency rank 22432/72933
śyāmāvadāta adjective dazzling black or blackish white (Monier-Williams, Sir M. (1988))

Frequency rank 68131/72933
śyāvadantaka noun (masculine) [medic.] a kind of disease of the teeth
Frequency rank 40175/72933
śyāvadantatā noun (feminine) a disease discolouring the teeth
Frequency rank 40176/72933
śvadaṃṣṭra noun (masculine) a kind of animal a kind of plant
Frequency rank 17316/72933
śvadaṃṣṭrā noun (feminine) Asteracantha longifolia Nees. (Monier-Williams, Sir M. (1988))
Hygrophila spinosa T. Anders Ruellia longifolia Roxb. Tribulus terrestris Linn.
Frequency rank 5580/72933
śvadaṃṣṭraka noun (masculine) Tribulus Lanuginosus (Monier-Williams, Sir M. (1988))

Frequency rank 68330/72933
śvanāvadhū noun (feminine) a kind of plant
Frequency rank 68332/72933
ṣaḍvadana noun (masculine) name of Skanda (Monier-Williams, Sir M. (1988))

Frequency rank 30654/72933
sattvadhātu noun (masculine) animated nature (Monier-Williams, Sir M. (1988))
the animal sphere (Monier-Williams, Sir M. (1988))

Frequency rank 40326/72933
saptavadhri noun (masculine) name of an Ātreya (protected by the Aśvins and author of the hymns) (Monier-Williams, Sir M. (1988))

Frequency rank 40374/72933
samavadhāna noun (neuter) great attention (Monier-Williams, Sir M. (1988))
meeting (Monier-Williams, Sir M. (1988))
preparation (Monier-Williams, Sir M. (1988))
the being brought together (Monier-Williams, Sir M. (1988))

Frequency rank 68979/72933
sarvadaṇḍadhara noun (masculine) Śiva (punishing every one) (Monier-Williams, Sir M. (1988))

Frequency rank 69458/72933
sarvadamana noun (masculine) name of an Asura (Monier-Williams, Sir M. (1988))
name of Bharata (Monier-Williams, Sir M. (1988))

Frequency rank 40533/72933
sarvadā indeclinable always (Monier-Williams, Sir M. (1988))
at all times (often joined with sarvatra and sarvathā) (Monier-Williams, Sir M. (1988))

Frequency rank 1243/72933
sarvadevahrada noun (masculine) name of a lake
Frequency rank 69459/72933
sarvadhātama adjective
Frequency rank 69460/72933
sarvadhātuka noun (neuter) copper
Frequency rank 69461/72933
sarvadhārin noun (masculine) name of the 22nd year of Jupiter's cycle of 60 years (Monier-Williams, Sir M. (1988))
name of Śiva (Monier-Williams, Sir M. (1988))

Frequency rank 40534/72933
sahasravadana noun (masculine) name of Viṣṇu (Monier-Williams, Sir M. (1988))

Frequency rank 69693/72933
saṃdaṃśavadana noun (masculine) a heron
Frequency rank 69862/72933
saṃvad verb (class 1 ātmanepada) to address (acc.) to call to coincide to converse with (instr.) or about to designate to fit together (so as to give one sense) to name (two acc.) to sound together or in concord (said of musical instruments) to speak to speak to
Frequency rank 7491/72933
saṃvivad verb (class 1 ātmanepada)
Frequency rank 70103/72933
sārvadhātuka noun (neuter) name of the verbal terminations of the four conj. tenses (Monier-Williams, Sir M. (1988))

Frequency rank 12279/72933
sāvadya adjective liable to blame or censure (Monier-Williams, Sir M. (1988))
objectionable (Monier-Williams, Sir M. (1988))

Frequency rank 22632/72933
sāvadhāna adjective attentive (Monier-Williams, Sir M. (1988))
careful (Monier-Williams, Sir M. (1988))
having attention (Monier-Williams, Sir M. (1988))
heedful (Monier-Williams, Sir M. (1988))
intent upon doing anything (inf.) (Monier-Williams, Sir M. (1988))

Frequency rank 12281/72933
sāvadhāraṇa adjective having a limitation or restriction (Monier-Williams, Sir M. (1988))
limited (Monier-Williams, Sir M. (1988))
restricted (Monier-Williams, Sir M. (1988))

Frequency rank 40828/72933
suvadana adjective having a handsome or beautiful face (Monier-Williams, Sir M. (1988))

Frequency rank 71200/72933
suvadanā noun (feminine) a beautiful woman (Monier-Williams, Sir M. (1988))
a kind of metre (Monier-Williams, Sir M. (1988))
name of a woman (Monier-Williams, Sir M. (1988))

Frequency rank 71201/72933
susvadha noun (masculine) name of a particular class of deceased ancestors (Monier-Williams, Sir M. (1988))

Frequency rank 71376/72933
sruvadruma noun (masculine)
Frequency rank 72005/72933
svadi noun (masculine) [gramm.] the verb svad
Frequency rank 72073/72933
svad verb (class 1 ātmanepada)
Frequency rank 16306/72933
svadana noun (neuter) eating (Monier-Williams, Sir M. (1988))
enjoying (Monier-Williams, Sir M. (1988))
licking (Monier-Williams, Sir M. (1988))
the act of tasting (Monier-Williams, Sir M. (1988))

Frequency rank 72074/72933
svadita adjective savoury (Monier-Williams, Sir M. (1988))
well seasoned or prepared (Monier-Williams, Sir M. (1988))

Frequency rank 72075/72933
svadita noun (neuter) "may it be well tasted or eaten!" (an exclamation used at a Śrāddha after presenting the oblation of food to the Pitṛs) (Monier-Williams, Sir M. (1988))

Frequency rank 31208/72933
svadṛś adjective seeing one's self or the soul (Monier-Williams, Sir M. (1988))

Frequency rank 22731/72933
svadyota noun (masculine)
Frequency rank 72076/72933
svadha adjective
Frequency rank 72077/72933
svadhā noun (feminine) (with dat. or gen.) the exclamation or benediction used on presenting (or as a substitute for) the above oblation or libation to the gods or departed ancestors (Monier-Williams, Sir M. (1988))
comfort (Monier-Williams, Sir M. (1988))
custom (Monier-Williams, Sir M. (1988))
ease (Monier-Williams, Sir M. (1988))
habitual state (Monier-Williams, Sir M. (1988))
inherent power (Monier-Williams, Sir M. (1988))
law (Monier-Williams, Sir M. (1988))
name of an attendant of Devī (K.R. von Kooji (1972), 51) own place (Monier-Williams, Sir M. (1988))
own state or condition or nature (Monier-Williams, Sir M. (1988))
rule (Monier-Williams, Sir M. (1988))
self-position (Monier-Williams, Sir M. (1988))
self-power (Monier-Williams, Sir M. (1988))
the sacrificial offering due to each god (Monier-Williams, Sir M. (1988))

Frequency rank 3930/72933
svadharma noun (masculine) one's own duty (Monier-Williams, Sir M. (1988))
one's own rights (Monier-Williams, Sir M. (1988))
peculiar property (Monier-Williams, Sir M. (1988))
peculiarity (Monier-Williams, Sir M. (1988))

Frequency rank 1920/72933
svadhākara adjective next (Monier-Williams, Sir M. (1988))
offering libations and oblations to deceased ancestors or deified progenitors (Monier-Williams, Sir M. (1988))

Frequency rank 72078/72933
svadhākāra noun (masculine) pronouncing the benediction svadhā or the exclamation itself (Monier-Williams, Sir M. (1988))

Frequency rank 18674/72933
svadhājit noun (masculine) name of a son of Sumitraka
Frequency rank 72079/72933
svadhābhuj noun (masculine) prec (Monier-Williams, Sir M. (1988))
a god (Monier-Williams, Sir M. (1988))

Frequency rank 41296/72933
svadhāman noun (masculine) name of a class of gods under the 3rd Manu (Monier-Williams, Sir M. (1988))
name of a son of Satyasahas and Sūnṛtā (Monier-Williams, Sir M. (1988))

Frequency rank 25984/72933
svadhāvant noun (masculine) a class of Pitṛs (Monier-Williams, Sir M. (1988))

Frequency rank 72080/72933
svadhiti noun (masculine feminine) (according to some) a large tree with hard wood (Monier-Williams, Sir M. (1988))
a saw (Monier-Williams, Sir M. (1988))
an axe (Monier-Williams, Sir M. (1988))

Frequency rank 72081/72933
svadhiṣṭhita adjective good to be stood on or lived in (acc.) (Monier-Williams, Sir M. (1988))
well-guided (as an elephant) (Monier-Williams, Sir M. (1988))

Frequency rank 72082/72933
svadhīta noun (neuter) anything well repeated or learned (Monier-Williams, Sir M. (1988))

Frequency rank 72083/72933
svadhur adjective independence (Monier-Williams, Sir M. (1988))
self-dependent (Monier-Williams, Sir M. (1988))

Frequency rank 72084/72933
svadhṛti noun (feminine) standing still of one's self (Monier-Williams, Sir M. (1988))

Frequency rank 72085/72933
hiraṇyāśvadāna noun (neuter) name of Liṅgapurāṇa, 2.39
Frequency rank 72609/72933
Ayurvedic Medical
Dictionary
Dr. Potturu with thanks
Purchase Kindle edition
 

amaradāru,amarataru

Go to devadāru.

āragvadha

Plant purging fistula, Cassia fistula, C. rhombifolia; golden shower tree; pudding pipe tree.

avadarana

breaking, shattering.

avadhūta

he who has shed everything, an asceti Century

devadāli

Plant bristly luffa, thorn gourd, Luffa echinata.

devadāru

Plant Himalayan cedar, heart wood of Cedrus deodara.

devadundhubhi

1. divine drum; 2. Plant holy basil with red flowers.

devadhūpa

resin of sal tree, Plant Shorea robusta.

devakāṣṭam

Go to devadāru

kṣavadhu

sneezing.

navadhānya

new grain.

pañcabhṛnga

Plant devadāli, śami, bhṛnga, nirgunḍi, śana.

pīlu

1. Plant toothbrush tree, Salvadora persica; 2. atom, tiniest part of matter.

pūrvadeśa

eastern region.

śyāvadanta

dark or discouled teeth.

vadana

face.

vibho

all pervading.

vyavāyi

diffusive, pervading, those pervading the entire body before getting digested.

Wordnet Search
"vad" has 331 results.

vad

gatāvadhika   

yasya upayuktatāyāḥ avadhiḥ samāptaḥ।

gatāvadhikāni bheṣajāni na upayoktavyāni।

vad

utsavaḥ, parva, parvāhaḥ, parvarīṇam, utsavadinam, mahaḥ, mahaḥ, uddharṣaḥ, yātrā, uddhavaḥ, kṣaṇaḥ, abhyudayaḥ, carcarī   

kimapi dhārmikaṃ sāmājikaṃ vā maṅgalaṃ vā śubhaṃ kāryaṃ yat sotsāhaṃ nirvartyate।

svataṃtratādinam asmākaṃ rāṣṭriyaḥ utsavaḥ asti।

vad

tvadīya, tava, bhavataḥ, bhavadīyaḥ, bhāvatkaḥ, yauṣmākaḥ, yauṣmākīṇaḥ   

prāṅmukhasya।

śobhanaṃ tvadīyaṃ gṛham।

vad

vivad   

vimatyanukūlaḥ vyāpāraḥ।

saḥ gṛhe sthitvā vivadate।

vad

mukham, āsyam, vadanam, tuṇḍam, vaktram, ānanam, lapanam   

ā oṣṭhāt galādiparyantam śarīrāvayavaviśeṣaḥ yena prāṇinaḥ vadanti adanti ca।

atyadhikabhayāt tasya mukhāt dhvanireva na niḥsṛtaḥ।

vad

navadhābhaktiḥ, navavidhābhaktiḥ   

dhārmikagranthānusāreṇa navaprakārakā bhaktiḥ।

kaliyuge navadhābhaktyāyāṃ kīrtanam atīva mahattvapūrṇam asti।

vad

cāṭuka, vācāṭa, vāvaduka, vitaṇḍaka, jalpaka   

yaḥ punaḥ punaḥ nirarthakaṃ vadati।

rāmaḥ cāṭukaḥ asti।

vad

madhyakālaḥ, kālāntaram, abhyantarakālaḥ, avakāśaḥ, avadhiḥ   

krīḍādiṣu bhāgadvayāntargataḥ virāmakālaḥ।

krīḍāyāḥ madhyakāle ahaṃ kaṣāyapānārtham agaccham।

vad

mūlyavaddhātuḥ   

saḥ dhātuḥ yaḥ mūlyavān asti।

suvarṇaḥ ekaḥ mūlyavān dhātuḥ asti।

vad

jīvadravyakam   

ekaḥ jīvasamūhaḥ yasmin kośikābhittiḥ nāsti paraṃ kośārasena sambaddhaḥ asti।

ācāryaḥ phalake jīvadravyakam ārekhitvā chātrān pāṭhayati।

vad

jīvadravyam   

kośikāyāṃ vartamānaḥ sajīvapadārthaḥ।

jīvadravye jalasya mātrā adhikā asti।

vad

apa man, nikṛ, ava man, ava jñā, tiraskṛ, pari bhū, ā dhṛṣ, ava dhṛṣ, ni u, garh, ā kṣip, adhi kṣip, ā kṣar, apa vad, pari vad, kuts, laghū kṛ   

kṛtyā vacanena vā kasy api avamānaṃ kṛtvā adhodarśanānukūlavyāpāraḥ।

saḥ sarveṣāṃ puraḥ mām apāmanyata।

vad

mukham, vadanam, ānanam, vaktram, āsyam, vandanam, cubram, śman   

avayavaviśeṣaḥ, oṣṭhau ca dantamūlāni dantā jihvā ca tālu ca galo galādi sakalam saptāṅgaṃ mukham ucyate।

pitā snehāt svabālakasya mukham cumbati।

vad

uśīraḥ, abhayam, naladam, sevyam, amṛṇālam, jalāśayam, lāmajjakam, laghulayam, avadāham, iṣṭakāpatham, uṣīram, mṛṇālam, laghu, layam, avadānam, iṣṭam, kāpatham, avadāheṣṭakāpatham, indraguptam, jalavāsam, haripiriyam, vīram, vīraṇam, samagandhikam, raṇapriyam, vīrataru, śiśiram, śītamūlakam, vitānamūlakam, jalamedas, sugandhikam, sugandhimūlakam, kambhu   

mālādūrvāyāḥ sugandhitaṃ mūlam।

vāyuśītake uśīraṃ prayujyate।

vad

dravaḥ, rasaḥ, dravadravyaḥ   

saḥ padārthaḥ yasmin tāralyam asti।

jalaṃ dravaḥ asti।

vad

yavanikā, javanikā, apaṭī, tiraskaraṇī, vyavadhānam, āvaraṇam, tirodhānam, āvaraṇapaṭaḥ, pracchadapaṭaḥ, nīśāraḥ   

dvārādiṣu vātādīnāṃ saṃvāraṇārthe avalagnaṃ vastram।

tasya dvāre jīrṇā yavanikā asti।

vad

garvita, garvin, sagarva, garvara, garvavat, garvitacitta, sadarpa, darpavān, darpī, mānī, ahaṅkārī, ahaṃyu, sāhaṅkāra, ahamānī, pragalbha, uddhata, uddhatacitta, uddhatamanas, samuddhata, prauḍha, unnaddha, samunnaddha, sāṭopa, āṭopī, utsikta, unnataśiraska, unnatamanaska, samunnatacitta, ūrdhvadṛṣṭi, avalipta, darpaghmāta, sāvahela, pradhṛṣṭa   

yaḥ garvaṃ karoti।

rājeśaḥ garvitaḥ।

vad

tamisrapakṣaḥ, kṛṣṇapakṣaḥ, vadyapakṣaḥ   

cāndramāsasya tāni pañcadaśāni dināni yeṣu tamo vardhate।

tamisrapakṣepi saha priyābhirjyotsnā vato nirvaśati pradoṣāt।

vad

śavadāhagṛham   

nagarādiṣu śavadahanārthe vinirmitaṃ gṛham।

janāḥ tasya śavaṃ gṛhītvā śavadāhagṛhaṃ gacchanti।

vad

gaura, avadāta, anavarṇa   

yasya varṇaḥ śvetaḥ।

prāyaḥ janāḥ snuṣāṃ gaurīm icchanti।

vad

pakva, pariṇata, paripakva, supakva, paktrima, pakvatāpanna, pakvadaśāpanna, pakvadaśāprāpta   

rasapūrṇaṃ mṛdu tathā ca pariṇataṃ phalam/ kaṭhīnasya annasya mṛdubhūtam annam।

saḥ pakvam āmraṃ khādati।

vad

śukla, dhavala, śveta, sita, śyeta, śubhra, śuci, avadāta, viśada, gaura, dhauta, pāṇḍura, amala, vimala, rajata, karka, kharu, arjuna, śiti, valakṣa, arjunachavi   

varṇaviśeṣaḥ।

saḥ śvetaṃ vastraṃ parigṛhṇāti।

vad

cintanīya, cintya, vicāraṇīya, vicārya, anuśīlanīya, lakṣya, abhilakṣya, avadheya   

cintanayogyam।

etad cintanīyaṃ prakaraṇam।

vad

sandhānam, samavadhānam, sajjīkaraṇam, sajja, racanam, racanā, viracanam, viracanā, upākarma, sambhāra, sambhṛti   

kāryārambhāt prāk kṛtaṃ karma।

sīmāyāḥ vivāhasya sandhānaṃ kriyate।

vad

suspaṣṭa, sphuṭa, pravyakta, ulvaṇa, prakaṭa, viśada, avadāta, iddha   

yad kena api vyavadhānena vinā sampūrṇatayā dṛśyate spaṣṭīkaroti vā।

ācāryaḥ chātrān pācanatantraṃ kṛṣṇaphalake tasya suspaṣṭaṃ citram ālikhya pāṭhitavān।

vad

avadhiḥ, kālāntaram, kālāvadhiḥ, antaram   

kārya samāpanārtham samprāptaḥ kālaḥ।

ṛṇapratyarpaṇāya bhavate caturṇāṃ dinānām avadhiḥ dīyate।

vad

niravadya, sabhya, ślīla, amala, anavadya   

yaḥ na aślīlaḥ।

saḥ niravadyaṃ sāhityam anubhavati।

vad

daivam, bhāgyam, bhāgaḥ, bhāgadheyam, daivayogaḥ, daivagatiḥ, daivadaśā, daivikam, diṣṭam, niyatiḥ, vidhiḥ   

yadanu manuṣyasya sarvakarmāṇi pūrvaṃ niścitāni bhavanti lalāṭadeśaśca yasya sthānatvena abhimataḥ tat anivāryaṃ tatvam।

karmavādī daive na viśvasiti। / daivaṃ caivātra pañcamam।

vad

dūradarśin, agradarśin, anāgatadarśin, anāgatadarśin, pūrvadarśin, bhaviṣyadarśin, antarajña, prapaśyat, krāntadarśin   

yaḥ bhaviṣyat kālasthitāṃ dūrasthāṃ ghaṭanāṃ paśyati cintayati vā।

dūradarśī samasyāyāṃ na nimijyati।

vad

bhaṅgaḥ, bhaṅgam, bhaṅgā, avadāraḥ, viśakalaḥ, viśakalam, viśakalā   

bhañjanasya kriyā bhāvo vā।

krīḍānakasya bhaṅgena bālakaḥ rodīti।

vad

sāvadhika   

yasyāṃ yasya vā ko'pi avadhiḥ asti।

śyāmaḥ sāvadhikāyāṃ puñjīyojanāyāṃ dhanaṃ viyojitavān।

vad

paṭay, avadal, avapaṭ, ādṝ, sphuṭ   

suṣiravastunaḥ āvaraṇe chedānukūlaḥ vyāpāraḥ yena antarnihitāni vastūni bahiḥ patanti dṛśyante vā।

tasya poṭalikā apaṭayat tataḥ sarvāṇi vastūni adhvani pravikīrṇāni ca।

vad

mūlyavadratnam   

tad ratnaṃ yad mūlyavat asti।

indranīlakaḥ mūlyavadratnam asti।

vad

svadeśaḥ   

svasya deśaḥ।

amerikādeśe gataḥ saḥ svadeśe pratyāgataḥ।

vad

abhibhāṣ, ābhāṣ, paribhāṣ, anubhāṣ, vad, saṃvibhāṣ, samabhibhāṣ, samabhidhā, āmantr   

sabhāsu śrotṝn uddiśya svavicāraprakaṭīkaraṇānukūlaḥ vyāpāraḥ।

mukhyaḥ atithiḥ vinayam adhikṛtya abhyabhāṣata।

vad

sampravad, sambhāṣ, saṃlap, abhibhāṣ, saṃvac, saṃvad, saṃjalp   

dvayoḥ athavā bahūnāṃ janānāṃ kim api viṣayam adhikṛtya parasparabhāṣaṇānukūlaḥ vyāpāraḥ।

vayaṃ sarve bhavataḥ viṣaye eva sampravadāmaḥ sma।

vad

nirmala, vimala, pavitra, śuddha, śuci, amalina, pariṣkṛta, akalka, akalmaṣa, vīghra, svaccha, viśuddha, amlāna, avadāta, iddha   

yaḥ malahīnaḥ doṣarahito vā।

nirmalena manasā arcanā kartavyā।

vad

sāvadhānam, sākūtam, avadhānāt, avahitam, manaḥpraveśena, pramāda-vyatirekeṇa   

samyak avadhānena saha vinā kim api pramādāt vā।

kimapi kāryaṃ sāvadhānaṃ kuru।

vad

jalam, vāri, ambu, ambhaḥ, payaḥ, salilam, sarilam, udakam, udam, jaḍam, payas, toyam, pānīyam, āpaḥ, nīram, vāḥ, pāthas, kīlālam, annam, apaḥ, puṣkaram, arṇaḥ, peyam, salam, saṃvaram, śaṃvaram, saṃmbam, saṃvatsaram, saṃvavaraḥ, kṣīram, pāyam, kṣaram, kamalam, komalam, pīvā, amṛtam, jīvanam, jīvanīyam, bhuvanam, vanam, kabandham, kapandham, nāram, abhrapuṣpam, ghṛtam, kaṃ, pīppalam, kuśam, viṣam, kāṇḍam, savaram, saram, kṛpīṭam, candrorasam, sadanam, karvuram, vyoma, sambaḥ, saraḥ, irā, vājam, tāmarasa, kambalam, syandanam, sambalam, jalapītham, ṛtam, ūrjam, komalam, somam, andham, sarvatomukham, meghapuṣpam, ghanarasaḥ, vahnimārakaḥ, dahanārātiḥ, nīcagam, kulīnasam, kṛtsnam, kṛpīṭam, pāvanam, śaralakam, tṛṣāham, kṣodaḥ, kṣadmaḥ, nabhaḥ, madhuḥ, purīṣam, akṣaram, akṣitam, amba, aravindāni, sarṇīkam, sarpiḥ, ahiḥ, sahaḥ, sukṣema, sukham, surā, āyudhāni, āvayāḥ, induḥ, īm, ṛtasyayoniḥ, ojaḥ, kaśaḥ, komalam, komalam, kṣatram, kṣapaḥ, gabhīram, gambhanam, gahanam, janma, jalāṣam, jāmi, tugryā, tūyam, tṛptiḥ, tejaḥ, sadma, srotaḥ, svaḥ, svadhā, svargāḥ, svṛtikam, haviḥ, hema, dharuṇam, dhvasmanvatu, nāma, pavitram, pāthaḥ, akṣaram, pūrṇam, satīnam, sat, satyam, śavaḥ, śukram, śubham, śambaram, vūsam, vṛvūkam, vyomaḥ, bhaviṣyat, vapuḥ, varvuram, varhiḥ, bhūtam, bheṣajam, mahaḥ, mahat, mahaḥ, mahat, yaśaḥ, yahaḥ, yāduḥ, yoniḥ, rayiḥ, rasaḥ, rahasaḥ, retam   

sindhuhimavarṣādiṣu prāptaḥ dravarupo padārthaḥ yaḥ pāna-khāna-secanādyartham upayujyate।

jalaṃ jīvanasya ādhāram। /ajīrṇe jalam auṣadhaṃ jīrṇe balapradam। āhārakāle āyurjanakaṃ bhuktānnopari rātrau na peyam।

vad

asāvadhānataḥ, asāvadhānena, anavahitam, avadhānaṃ vinā, sapramādam, pramādāt, pramādataḥ, pramādyataḥ, pramattam, pramattavat, asamīkṣya, avimṛśya, nirapekṣam, anapekṣayā   

karmaphalasya asamyak pūrvacintanāt sahasā kṛtam।

asāvadhānataḥ vegena vāhanasaṃñcālanaṃ prāṇaghātī asti।

vad

śivaḥ, śambhuḥ, īśaḥ, paśupatiḥ, pinākapāṇiḥ, śūlī, maheśvaraḥ, īśvaraḥ, sarvaḥ, īśānaḥ, śaṅkaraḥ, candraśekharaḥ, phaṇadharadharaḥ, kailāsaniketanaḥ, himādritanayāpatiḥ, bhūteśaḥ, khaṇḍaparaśuḥ, girīśaḥ, giriśaḥ, mṛḍaḥ, mṛtyañjayaḥ, kṛttivāsāḥ, pinākī, prathamādhipaḥ, ugraḥ, kapardī, śrīkaṇṭhaḥ, śitikaṇṭhaḥ, kapālabhṛt, vāmadevaḥ, mahādevaḥ, virūpākṣaḥ, trilocanaḥ, kṛśānuretāḥ, sarvajñaḥ, dhūrjaṭiḥ, nīlalohitaḥ, haraḥ, smaraharaḥ, bhargaḥ, tryambakaḥ, tripurāntakaḥ, gaṅgādharaḥ, andhakaripuḥ, kratudhvaṃsī, vṛṣadhvajaḥ, vyomakeśaḥ, bhavaḥ, bhaumaḥ, sthāṇuḥ, rudraḥ, umāpatiḥ, vṛṣaparvā, rerihāṇaḥ, bhagālī, pāśucandanaḥ, digambaraḥ, aṭṭahāsaḥ, kālañjaraḥ, purahiṭ, vṛṣākapiḥ, mahākālaḥ, varākaḥ, nandivardhanaḥ, hīraḥ, vīraḥ, kharuḥ, bhūriḥ, kaṭaprūḥ, bhairavaḥ, dhruvaḥ, śivipiṣṭaḥ, guḍākeśaḥ, devadevaḥ, mahānaṭaḥ, tīvraḥ, khaṇḍaparśuḥ, pañcānanaḥ, kaṇṭhekālaḥ, bharuḥ, bhīruḥ, bhīṣaṇaḥ, kaṅkālamālī, jaṭādharaḥ, vyomadevaḥ, siddhadevaḥ, dharaṇīśvaraḥ, viśveśaḥ, jayantaḥ, hararūpaḥ, sandhyānāṭī, suprasādaḥ, candrāpīḍaḥ, śūladharaḥ, vṛṣāṅgaḥ, vṛṣabhadhvajaḥ, bhūtanāthaḥ, śipiviṣṭaḥ, vareśvaraḥ, viśveśvaraḥ, viśvanāthaḥ, kāśīnāthaḥ, kuleśvaraḥ, asthimālī, viśālākṣaḥ, hiṇḍī, priyatamaḥ, viṣamākṣaḥ, bhadraḥ, ūrddharetā, yamāntakaḥ, nandīśvaraḥ, aṣṭamūrtiḥ, arghīśaḥ, khecaraḥ, bhṛṅgīśaḥ, ardhanārīśaḥ, rasanāyakaḥ, uḥ, hariḥ, abhīruḥ, amṛtaḥ, aśaniḥ, ānandabhairavaḥ, kaliḥ, pṛṣadaśvaḥ, kālaḥ, kālañjaraḥ, kuśalaḥ, kolaḥ, kauśikaḥ, kṣāntaḥ, gaṇeśaḥ, gopālaḥ, ghoṣaḥ, caṇḍaḥ, jagadīśaḥ, jaṭādharaḥ, jaṭilaḥ, jayantaḥ, raktaḥ, vāraḥ, vilohitaḥ, sudarśanaḥ, vṛṣāṇakaḥ, śarvaḥ, satīrthaḥ, subrahmaṇyaḥ   

devatāviśeṣaḥ- hindūdharmānusāraṃ sṛṣṭeḥ vināśikā devatā।

śivasya arcanā liṅgarūpeṇa pracalitā asti।

vad

vighnaḥ, antarāyaḥ, pratyūhaḥ, vyavadhānam   

yad kāryaṃ vihanyate।

asmin kārye vighnaṃ na āgacchet ataḥ vighnavināyakaṃ pūjayāmi।

vad

viṣṇuḥ, nārāyaṇaḥ, kṛṣṇaḥ, vaikuṇṭhaḥ, viṣṭaraśravāḥ, dāmodaraḥ, hṛṣīkeśaḥ, keśavaḥ, mādhavaḥ, svabhūḥ, daityāriḥ, puṇḍarīkākṣaḥ, govindaḥ, garuḍadhvajaḥ, pītāmbaraḥ, acyutaḥ, śārṅgī, viṣvaksenaḥ, janārdanaḥ, upendraḥ, indrāvarajaḥ, cakrapāṇiḥ, caturbhujaḥ, padmanābhaḥ, madhuripuḥ, vāsudevaḥ, trivikramaḥ, daivakīnandanaḥ, śauriḥ, śrīpatiḥ, puruṣottamaḥ, vanamālī, balidhvaṃsī, kaṃsārātiḥ, adhokṣajaḥ, viśvambharaḥ, kaiṭabhajit, vidhuḥ, śrīvatsalāñachanaḥ, purāṇapuruṣaḥ, vṛṣṇiḥ, śatadhāmā, gadāgrajaḥ, ekaśṛṅgaḥ, jagannāthaḥ, viśvarūpaḥ, sanātanaḥ, mukundaḥ, rāhubhedī, vāmanaḥ, śivakīrtanaḥ, śrīnivāsaḥ, ajaḥ, vāsuḥ, śrīhariḥ, kaṃsāriḥ, nṛhariḥ, vibhuḥ, madhujit, madhusūdanaḥ, kāntaḥ, puruṣaḥ, śrīgarbhaḥ, śrīkaraḥ, śrīmān, śrīdharaḥ, śrīniketanaḥ, śrīkāntaḥ, śrīśaḥ, prabhuḥ, jagadīśaḥ, gadādharaḥ, ajitaḥ, jitāmitraḥ, ṛtadhāmā, śaśabinduḥ, punarvasuḥ, ādidevaḥ, śrīvarāhaḥ, sahasravadanaḥ, tripāt, ūrdhvadevaḥ, gṛdhnuḥ, hariḥ, yādavaḥ, cāṇūrasūdanaḥ, sadāyogī, dhruvaḥ, hemaśaṅkhaḥ, śatāvarttī, kālanemiripuḥ, somasindhuḥ, viriñciḥ, dharaṇīdharaḥ, bahumūrddhā, vardhamānaḥ, śatānandaḥ, vṛṣāntakaḥ, rantidevaḥ, vṛṣākapiḥ, jiṣṇuḥ, dāśārhaḥ, abdhiśayanaḥ, indrānujaḥ, jalaśayaḥ, yajñapuruṣaḥ, tārkṣadhvajaḥ, ṣaḍbinduḥ, padmeśaḥ, mārjaḥ, jinaḥ, kumodakaḥ, jahnuḥ, vasuḥ, śatāvartaḥ, muñjakeśī, babhruḥ, vedhāḥ, prasniśṛṅgaḥ, ātmabhūḥ, suvarṇabinduḥ, śrīvatsaḥ, gadābhṛt, śārṅgabhṛt, cakrabhṛt, śrīvatsabhṛt, śaṅkhabhṛt, jalaśāyī, muramardanaḥ, lakṣmīpatiḥ, murāriḥ, amṛtaḥ, ariṣṭanemaḥ, kapiḥ, keśaḥ, jagadīśaḥ, janārdanaḥ, jinaḥ, jiṣṇuḥ, vikramaḥ, śarvaḥ   

devatāviśeṣaḥ hindudharmānusāraṃ jagataḥ pālanakartā।

ekādaśastathā tvaṣṭā dvādaśo viṣṇurucyate jaghanyajastu sarveṣāmādityānāṃ guṇādhikaḥ।

vad

candraḥ, kalānāthaḥ, kalādharaḥ, himāṃśuḥ, candramāḥ, kumudabāndhavaḥ, vidhuḥ, sudhāṃśuḥ, śubhrāṃśuḥ, oṣadhīśaḥ, niśāpatiḥ, abjaḥ, jaivātṛkaḥ, glauḥ, mṛgāṅkaḥ, dvijarājaḥ, śaśadharaḥ, nakṣatreśaḥ, kṣapākaraḥ, doṣākaraḥ, niśīthinīnāthaḥ, śarvarīśaḥ, eṇāṅkaḥ, śītaraśmiḥ, samudranavanītaḥ, sārasaḥ, śvetavāhanaḥ, nakṣatranāmiḥ, uḍupaḥ, sudhāsūtiḥ, tithipraṇīḥ, amatiḥ, candiraḥ, citrāṭīraḥ, pakṣadharaḥ, rohiṇīśaḥ, atrinetrajaḥ, pakṣajaḥ, sindhujanmā, daśāśvaḥ, māḥ, tārāpīḍaḥ, niśāmaṇiḥ, mṛgalāñchanaḥ, darśavipat, chāyāmṛgadharaḥ, grahanemiḥ, dākṣāyaṇīpati, lakṣmīsahajaḥ, sudhākaraḥ, sudhādhāraḥ, śītabhānuḥ, tamoharaḥ, tuśārakiraṇaḥ, pariḥ, himadyutiḥ, dvijapatiḥ, viśvapsā, amṛtadīdhitiḥ, hariṇāṅkaḥ, rohiṇīpatiḥ, sindhunandanaḥ, tamonut, eṇatilakaḥ, kumudeśaḥ, kṣīrodanandanaḥ, kāntaḥ, kalāvān, yāminījatiḥ, sijraḥ, mṛgapipluḥ, sudhānidhiḥ, tuṅgī, pakṣajanmā, abdhīnavanītakaḥ, pīyūṣamahāḥ, śītamarīciḥ, śītalaḥ, trinetracūḍāmaṇiḥ, atrinetrabhūḥ, sudhāṅgaḥ, parijñāḥ, sudhāṅgaḥ, valakṣaguḥ, tuṅgīpatiḥ, yajvanāmpatiḥ, parvvadhiḥ, kleduḥ, jayantaḥ, tapasaḥ, khacamasaḥ, vikasaḥ, daśavājī, śvetavājī, amṛtasūḥ, kaumudīpatiḥ, kumudinīpatiḥ, bhūpatiḥ, dakṣajāpatiḥ, oṣadhīpatiḥ, kalābhṛt, śaśabhṛt, eṇabhṛt, chāyābhṛt, atridṛgjaḥ, niśāratnam, niśākaraḥ, amṛtaḥ, śvetadyutiḥ, hariḥ   

khagolīyapiṇḍaḥ yaḥ pṛthvīṃ paribhramati।

adhunā mānavaḥ candrasya pṛṣṭhabhāgaṃ gatvā saṃśodhanaṃ karoti।

vad

nakulaḥ, piṅgalaḥ, sarpahā, babhruḥ, sūcīvadanaḥ, sarpāri, lohitānanaḥ   

jantuviśeṣaḥ yaḥ sarpam atti।

biḍālaḥ nakulam atti।

vad

avācya, avacanīya, akathanīya, akathya, avadya, asaṃbhāṣya, asambhāṣya   

yad kathanīyaṃ nāsti।

mama kecit anubhavāḥ avācyāḥ।

vad

cakṣuḥ, locanam, nayanam, netram, īkṣaṇam, akṣi, dṛk, dṛṣṭiḥ, ambakam, darśanam, tapanam, vilocanam, dṛśā, vīkṣaṇam, prekṣaṇaṃ, daivadīpaḥ, devadīpaḥ, dṛśiḥ, dśī   

avayavaviśeṣaḥ-darśanendriyam।

tasyāḥ cakṣuṃṣī mṛgīvat staḥ।

vad

śavadāhaḥ, dāha-saṃskāraḥ, dāhakriyā, dāhakarma, agnikarma, agnidāhaḥ   

śavasya jvalanam।

adhunā śavadāhasya kṛte nagareṣu vidyut śavadāhagṛhasya nirmāṇaṃ kṛtam।

vad

ghṛṇita, avadya, jugupsya, kutsita, vībhatsa, jaghanya, ghṛṇāspada, apakṛṣṭa   

ghṛṇārthe yogyaḥ।

bhrūṇahatyā ekaḥ ghṛṇitaḥ aparādhaḥ।

vad

pramattavat, anavadhāna, pramadvara   

avadhānahīnaḥ।

pramattavān vyaktiḥ vyasanaiḥ grasati।

vad

ruc, abhiruc, svad, juṣ, prī   

āsvādanānukūlaḥ vyāpāraḥ।

mahyam idaṃ kāryaṃ naiva rocate।

vad

kṛṣṇaḥ, nārāyaṇaḥ, dāmodaraḥ, hṛṣīkeśaḥ, keśavaḥ, mādhavaḥ, acyutaḥ, govindaḥ, janārdanaḥ, giridharaḥ, daivakīnandanaḥ, mādhavaḥ, śauriḥ, ahijitaḥ, yogīśvaraḥ, vaṃśīdharaḥ, vāsudevaḥ, kaṃsārātiḥ, vanamālī, purāṇapuruṣaḥ, mukundaḥ, kaṃsāriḥ, vāsuḥ, muralīdharaḥ, jagadīśaḥ, gadādharaḥ, nandātmajaḥ, gopālaḥ, nandanandanaḥ, yādavaḥ, pūtanāriḥ, mathureśaḥ, dvārakeśaḥ, pāṇḍavāyanaḥ, devakīsūnuḥ, gopendraḥ, govardhanadharaḥ, yadunāthaḥ, cakrapāṇiḥ, caturbhujaḥ, trivikramaḥ, puṇḍarīkākṣaḥ, garuḍadhvajaḥ, pītāmbaraḥ, viśvambharaḥ, viśvarujaḥ, sanātanaḥ, vibhuḥ, kāntaḥ, puruṣaḥ, prabhuḥ, jitāmitraḥ, sahasravadanaḥ   

yaduvaṃśīya vasudevasya putraḥ yaḥ viṣṇoḥ avatāraḥ iti manyate।

sūradāsaḥ kṛṣṇasya paramo bhaktaḥ।

vad

pṛthvī, dharatī, dharā, bhū, vasundharā, dharaṇī, dharitrī, avanī, urvī, ratnagarbhā, vasudhā, kṣitiḥ, mahiḥ, mahī, acalakīlā, acalā, bhūmaṇḍalaḥ, pṛthivīmaṇḍalam, viśvambharā, prathī, viśvadhāriṇī, medinī, viśvadhenā   

sauramālāyāṃ sūryaṃ paritaḥ bhramamāṇaḥ sūryāt tṛtīyaḥ martyādyadhiṣṭhānabhūtaḥ grahagolaḥ।

candraḥ pṛthveḥ upagrahaḥ asti।

vad

nirdhārita, niścita, vihita, niyata, avadhārita   

yad vidhīyate।

ahaṃ nirdhāritaṃ sthānam āgamiṣyāmi।

vad

īśvarapradatta, bhagavaddatta, prabhupradatta   

yaḥ īśvareṇa dattaḥ।

mānavasya jīvanam īśvarapradattam asti।

vad

asuravadhaḥ, asurasaṃhāraḥ   

kasyāpi asurasya vadhaḥ।

yadā pṛthivyām asurāṇām pīḍanaṃ vardhate tadā asuravadhaṃ kartum īśvaraḥ kenāpi rūpeṇa āgacchati।

vad

adyāvadhiḥ   

adya yāvat।

śyāmaḥ kutra asti iti adyāvadhiḥ na jñāyate saḥ dvimāsāt prāk utsave utpathitaḥ।

vad

adhama, pratikṛṣṭa, avamaḥ, nikṛṣṭa, arvā, rephaḥ, yāpyaḥ, kutsitaḥ, avadyaḥ, kupūyaḥ, kheṭaḥ, garhyaḥ, aṇakaḥ, repaḥ, aramaḥ, āṇakaḥ, anakaḥ   

yad atyantam apakṛṣṭam asti।

tava adhamāni kṛtyāni dṛṣṭvā klāntaḥ aham।

vad

avadhihīna   

aniścitaḥ avadhiḥ।

saḥ avadhihīnāyāḥ yātrāyāḥ agacchat daśame dine āgacchati śatadinān anantaraṃ vā।

vad

praphullavadana, phullavadana, suhāsānana, prasannavadana   

yasya vadane nityaṃ hāsyaḥ vartate।

praphullavadanā sā sarvebhyaḥ rocate।

vad

kiṃvadantī   

prāmāṇyena vinā jane prasṛtā mithyā vārtā।

kiṃvadanteḥ prāmāṇyaṃ parīkṣaṇīyam।

vad

prasannavadana   

yasya mukhaṃ prasannam।

prasannamukhā strī bālakaṃ dugdhaṃ pāyayati।

vad

strī, nārī, narī, mānuṣī, manuṣī, mānavī, lalanā, lalitā, ramaṇī, rāmā, vanitā, priyā, mahilā, yoṣā, yoṣitā, yoṣit, yoṣīt, vadhūḥ, bharaṇyā, mahelā, mahelikā, māninī, vāmā, aṅganā, abalā, kāminī, janiḥ, janī, joṣā, joṣitā, joṣit, dhanikā, parigṛhyā, pramadā, pratīpadarśinī, vilāsinī, sindūratilakā, sīmantinī, subhrūḥ, śarvarī   

manuṣyajātīyānāṃ strī-puṃrūpīyayoḥ prabhedadvayayoḥ prathamā yā prajananakṣamā asti।

adhunā vividheṣu kṣetreṣu strīṇām ādhipatyam vartate।

vad

indraḥ, devarājaḥ, jayantaḥ, ṛṣabhaḥ, mīḍhvān, marutvān, maghavā, viḍojā, pākaśāsanaḥ, vṛddhaśravāḥ, sunāsīraḥ, puruhūtaḥ, purandaraḥ, jiṣṇuḥ, lekharṣabhaḥ, śakraḥ, śatamanyuḥ, divaspatiḥ, sutrāmā, gotrabhit, vajrī, vāsavaḥ, vṛtrahā, vṛṣā, vāstospatiḥ, surapatiḥ, balārātiḥ, śacīpatiḥ, jambhabhedī, harihayaḥ, svārāṭ, namucisūdanaḥ, saṃkrandanaḥ, duścyavanaḥ, turāṣāṭ, meghavāhanaḥ, ākhaṇḍalaḥ, sahastrākṣaḥ, ṛbhukṣā, mahendraḥ, kośikaḥ, pūtakratuḥ, viśvambharaḥ, hariḥ, purudaṃśā, śatadhṛtiḥ, pṛtanāṣāḍ, ahidviṣaḥ, vajrapāṇiḥ, devarājaḥ, parvatāriḥ, paryaṇyaḥ, devatādhipaḥ, nākanāthaḥ, pūrvadikkapatiḥ, pulomāriḥ, arhaḥ, pracīnavarhiḥ, tapastakṣaḥ, biḍaujāḥ, arkaḥ, ulūkaḥ, kaviḥ, kauśikaḥ, jiṣṇuḥ   

sā devatā yā svargasya adhipatiḥ iti manyate।

vedeṣu indrasya sūktāni santi।

vad

patnī, jāyā, bhāryā, gṛhiṇī, vadhūḥ, janī, sahadharmiṇī, sahacarī, dārāḥ, kalatram, pāṇigṛhītī, sadharmiṇī, dharmācāriṇī, gṛhaḥ, kṣetram, parigrahaḥ, ūḍhā   

sā pariṇītā yā patyā udvāhavihītamantrādinā vedavidhānenoḍhā।

patnyāḥ guṇenaiva puruṣāḥ sukhino bhavanti।

vad

ananupekṣā, avadhānam, ādaraḥ, sammānam, ananyamanaskatā, avekṣaṇam, avahitatā   

upekṣāṃ vinā anyakathitasya bhāvasya manoniveśaḥ।

jyeṣṭhānāṃ vacaneṣu avadhānaṃ na dattvā saḥ svacchandam ācarati| / vṛddhopadeśasya ananupekṣā na karaṇīyā।

vad

maryādā, sīmā, avadhiḥ   

kasyāpi kāryasya padārthasya vā iyattā yām anu tat kāryaṃ sambhavati।

kimapi kāryaṃ maryādām anatikrāntvā karaṇīyam।/ atikrāntaśca maryādāṃ kāvyaitatkathayāmi te।

vad

asuraḥ, daityaḥ, daiteyaḥ, danujaḥ, indrāriḥ, dānavaḥ, śukraśiṣyaḥ, ditisutaḥ, pūrvadevaḥ, suradviṭ, devaripuḥ, devāriḥ, kauṇapaḥ, kravyāt, kravyādaḥ, asrapaḥ, āśaraḥ, rātriñcaraḥ, rātricaraḥ, kavvūraḥ, nikaṣātmajaḥ, yātudhānaḥ, puṇyajanaḥ, nairṛtaḥ, yātuḥ, rakṣaḥ, sandhyābalaḥ, kṣapāṭaḥ, rajanīcaraḥ, kīlāpāḥ, nṛcakṣāḥ, naktañcaraḥ, palāśī, palāśaḥ, bhūtaḥ, nīlāmbaraḥ, kalmāṣaḥ, kaṭaprūḥ, agiraḥ, kīlālapaḥ, naradhiṣmaṇaḥ, khacaraḥ   

dharmagranthaiḥ varṇitāḥ te jīvāḥ ye dharmavirodhinaḥ kāryān akarot tathā ca devānāṃ ṛṣīṇāṃ ca śatravaḥ āsan।

purākāle asūrāṇāṃ bhayena dharmakārye kāṭhīnyam abhavat।

vad

aśokaḥ, śokanāśaḥ, viśokaḥ, vañjuladrumaḥ, vañjalaḥ, madhupuṣpaḥ, apaśokaḥ, kaṅkelliḥ, kelikaḥ, raktapallavaḥ, citraḥ, vicitraḥ, karṇapūraḥ, subhagaḥ, dohalī, tāmrapallavaḥ, rogitaruḥ, hemapuṣpaḥ, rāmā, vāmāṅgighātanaḥ, piṇḍīpuṣpaḥ, naṭaḥ, pallavadruḥ   

svanāmakhyātavṛkṣaviśeṣaḥ yaḥ sadā haritaḥ asti।

aśokaḥ bhārate sarvatra dṛśyate।

vad

āmram, cūtam, sahakāram, kāmaśaram, kāmavallabham, kāmāṅgam, kīrevṛḥ, mādhavadrumam, bhṛṅgāmīṣṭam, sīdhurasam, madhūlī, kokilotsavam, vasantadūtam, āmraphalam, modākhyam, manmathālayaḥ, madhvāvāsaḥ, sumadanaḥ, pikarāgaḥ, nṛpapriyaḥ, priyāmbuḥkokilāvāsaḥ, mākandaḥ, ṣaṭpadātithiḥ, madhuvrataḥ, vasantadruḥ, pikaprayaḥ, strīpriyaḥ, gandhabandhuḥ, alipriyaḥ, madirāsakhaḥ   

phalaviśeṣaḥ, āmravṛkṣasya phalam asya guṇāḥ varṇarucimāṃsaśukrabalakāritvam।

rāmāya āmraḥ rocate।

vad

āmraḥ, āmravṛkṣaḥ, cūtaḥ, sahakāraḥ, kāmaśaraḥ, kāmavallabhaḥ, kāmāṅgaḥ, kīrevṛḥ, mādhavadrumaḥ, bhṛṅgāmīṣṭaḥ, sīdhurasaḥ, madhūlī, kokilotsavaḥ, vasantadūtaḥ, amraphalaḥ, modākhyaḥ, manmathālayaḥ, madhvāvāsaḥ, sumadanaḥ, pikarāgaḥ, nṛpapriyaḥ, priyāmbuḥ, kokilāvāsaḥ, mākandaḥ, ṣaṭpadātithiḥ, madhuvrataḥ, vasantadruḥ, pikaprayaḥ, strīpriyaḥ, gandhabandhuḥ, alipriyaḥ, madirāsakhaḥ   

phalavṛkṣaviśeṣaḥ- dīrghajīvī pādapaḥ yasya pītavarṇīyaṃ phalam atīva madhuram।

āmravṛkṣe śukāḥ nivasanti।

vad

saṃvādaḥ, kathopakathanam, saṃlāpaḥ, sambhāṣā, sambhāṣaṇam, saṅkathā, saṃpravadanam, vīthyaṅgam   

rūpakādiṣu pātrāṇāṃ parasparālāpaḥ svagataṃ vā।

saṃskṛtanāṭake strīpātrāṇām saṃvādaḥ prākṛte asti।

vad

śikharī, viṣaghnikā, śvetadhāmā, vṛhatphalā, veśmakūlā, śikhī, mālākaṇṭhaḥ, argvadhā, keśaparṇī   

vanyakṣupaḥ yaḥ bheṣajarūpeṇa upayujyate।

vaidyena pīḍitāya śikhariṇaḥ satvasya sevanaṃ sūcitam।

vad

vaidyaḥ, cikītsakaḥ, bhiṣak, cikītsājīvī, agadakārakaḥ, rogaśāntakaḥ, rogahṛt, rogahā, jīvadaḥ   

yaḥ rogīṇāṃ rogalakṣaṇasya cikītsāṃ kṛtvā roganivaraṇārthe bheṣajaṃ yacchati। carakaḥ vaidyaḥ āsīt। vaidyaḥ rogiṇāṃ kṛte bhagavān iva। / carakaḥ vaidyaḥ āsīt।

vad

vad, vac, brū, kath, bhāṣ, abhilap, ābhāṣ, parijalp, samuccar, samābhāṣ, sambrū, sampravad, sambhāṣ, saṃvac, saṃlap   

āsyaprayatnābhyāṃ mukhāt vyaktaiḥ dhvanibhiḥ vāṅ-niṣpattyanukūlaḥ vyāpāraḥ।

sīmā ḍakārasya sthāne rephaṃ vadati।

vad

navadampatī, navajampatī   

navavivāhite patipatnī।

vivāhād anantaraṃ naike janāḥ navadampatīm āśirvādapradānārthe āgatāḥ।

vad

hatyā, vadhaḥ   

kamapi manuṣyaṃ prāṇinaṃ vā buddhyā niṣprāṇakaraṇam।

tena svasya pituḥ hatyā kṛtā।

vad

gaṇeśaḥ, gajānanaḥ, gaṇapatiḥ, lambodaraḥ, vakratuṇḍaḥ, vināyakaḥ, ākhuvāhanaḥ, ekadantaḥ, gajamukhaḥ, gajavadanaḥ, gaṇanāthaḥ, herambaḥ, bhālacandraḥ, vighnarājaḥ, dvaimāturaḥ, gaṇādhipaḥ, vighneśaḥ, parśupāṇiḥ, ākhugaḥ, śūrpakarṇaḥ, gaṇaḥ   

hindūnāṃ ekā pradhānā tathā ca agrapūjyā devatā yasya śarīraṃ manuṣyasya mastakaṃ tu gajasya asti।

gaṇeśasya vāhanaṃ mūṣakaḥ asti।

vad

kartavyam, dharmaḥ, svadharmaḥ, kartavyatā, kāryam, kṛtyam, kriyā, niyamaḥ, yamaḥ, vratam, dhurā, tapaḥ   

yat avaśyaṃ karaṇīyam।

deśasevā iti asmākaṃ paramaṃ kartavyam।

vad

śap, abhiśap, śapathaṃ kṛ, śapathaṃ śap, śapathapūrvaṃ kath, śapathapūrvaṃ vad, pratijñā, saṃśap, biṭ, biṭ   

kāryākāryasambandhī svaniścayarūpābhiprāyasya paratrāviṣkaraṇanukūlaḥ vyāpāraḥ।

bhīṣmaḥ aśapat ājīvanaṃ brahmacaryavratam ācarāmi iti।

vad

vac, kathaya, ācakṣ, vad, nivedaya, āvedaya, nirdiś, vijñāpaya, varṇaya, upanyas   

viṣayaviśeṣam adhikṛtya vākyaprabandhānukūlaḥ vyāpāraḥ।

adya ācāryaḥ hindūsaṃskṛtim adhikṛtya vakti।

vad

sambodhaya, saṃbodhaya, śās, bhāṣ, ābhāṣ, abhibhāṣ, sambhāṣ, paribhāṣ, vyābhāṣ, saṃvibhāṣ, samābhāṣ, samālap, ālap, abhimantr, sammantr, saṃmantr, anubhāṣ, abhidhā, samabhidhā, anuśās, abhijalp, anubrū, āvac, vad, āvad, upavad   

sabhādiṣu jamasāmānyān uddiśya codanānukūlaḥ vyāpāraḥ।

adya pradhānamantrī bahuviśālāṃ janasabhām samabodhayat।

vad

kṛt, chid, nikṛt, niṣkṛt, parikṛt, vikṛt, vinikṛt, paricchid, saṃchid, paricchid, lū, vraśc, cho, viccho, do, vido, dā, vidā, chuṭ, chur, takṣ, vitakṣ, parivas, parivraśc, paryavacchid, paryavado, pracchid, pralū, pravraśc, vas, vibhaj, vimath, vihṛ, vyapahṛ, samucchid, samutkṛt, samuparuj, sampracchid   

tīkṣṇaiḥ sādhanaiḥ kartanapūrvakaḥ vibhajanānukūlaḥ vyāpāraḥ।

saḥ kṣupān kartayati।

vad

nirākṛ, apavad, vivad, visaṃvad, vipravad, pratikṣip, vāraya, prativāraya, pratyākhyā, pratiniṣid, parāvac, pratividhā   

parasya matasya khaṇḍanānakūlaḥ vyāpāraḥ।

saḥ mama vacaḥ nirākaroti।

vad

garbhakālaḥ, garbhāvadhiḥ   

garbhadhāraṇāt prasavakālaṃ yāvat kālaḥ।

garbhakāle mātuḥ parirakṣaṇaṃ kartavyam।

vad

paraśuḥ, parśuḥ, paraśvadhaḥ, parśvadhaḥ, svadhitiḥ, kuṭhāraḥ   

śastraviśeṣaḥ।

tena śatruḥ paraśunā hataḥ।

vad

vārtā, vṛtāntaḥ, samācāraḥ, sandeśaḥ, sandiṣṭaḥ, savādaḥ, vṛttam, vartamānam, pravṛttiḥ, kiṃvadantī, udantaḥ, udantakaḥ, lokavādaḥ, lokapravādaḥ, janavādaḥ, janaśrutiḥ, vācikam, sūcanā   

ghaṭanānāṃ vṛttāntaḥ yaḥ ākāśavāṇīdūradarśanāditaḥ prāptaḥ।

pūrvaṃ bhavantaḥ hindībhāṣāyāṃ viśvasya vārtāḥ aśruṇvan।

vad

veśyā, gaṇikā, paṇyastrī, vārastrī, sādhāraṇastrī, vārāṅganā, bhogyā, paṇyāṅganā, bandhurā, vāravadhū, vārayuvatī, vāranārī, vāramukhī, vāravāṇī, vāravilāsinī, vārasundarī, vārakanyā, paṇasundarī, paṇastrī, veśayuvatī, veśavadhū, veśavanitā, veśastrī, veśmastrī, rūpajīvinīvāravadhū   

yā paṇyayogena sambhogaṃ kārayati।

kāścana mugdhāḥ bālikāḥ balāt veśyāḥ bhavanti।

vad

ātmaghātaḥ, ātmavadhaḥ, ātmahananam, ātmavyāpādanam, prāṇatyāgaḥ, dehatyāgaḥ, jīvitatyāgaḥ, jīvotsargaḥ, ātmadrohaḥ, kāmyamaraṇam, ātmahatyā   

svaprāṇanāśanam।

ātmaghātaḥ mahāpāpam।

vad

bhagavadgītā, gītā   

hindūnāṃ dhārmikaḥ granthaḥ yaḥ arjunasya mohanivṛttyarthe mahābhāratīyabhīṣmaparvāntargatā karmopāsanājñānakāṇḍatrayātmakaḥ aṣṭādaśādhyāyātmakaḥ।

bhagavadgītāyām aṣṭādaśa adhyāyāḥ santi।

vad

vadhri, vigatapuṃska, avṛṣaṇa   

vigataṃ puṃskaṃ yasya।

vadhriḥ paśuḥ yujyārhaḥ।

vad

cāṭukāra, saṃstāvaka, sāṃtvavādin, praśaṃsaka, priyaṃvada, cāṭuvādin, mithyāśaṃsaka   

yaḥ mithyāpriyavākyaṃ vadati।

saḥ cāṭukāraḥ asti।

vad

āvartaya, anupaṭh, abhyasya, prativad, pratyādā, samprabhāṣ, samuccar, anuvac, abhyāvṛt, parihṛ, kīrtaya   

kaṇṭhasthīkaraṇāya punaḥ punaḥ uccāraṇānukūlaḥ vyāpāraḥ।

bālakāḥ guṇanakoṣṭakam āvartayanti।

vad

prāk sūcaya, pratyādiś, prāk prabodhaya, sāvadhānīkṛ   

upasthitāpadviṣayiṇyaḥ athavā vātāvaraṇaviṣayiṇyaḥ dakṣatāyāḥ pūrvaṃ kathanānukūlaḥ vyāpāraḥ।

vāyuvidyāvibhāgaḥ dhīvarān asūcayat yat te samudram prati na gacchantu iti।

vad

bhāṣā, bhāṣaṇam, vāk, vāṇī, vācā, goḥ, girā, uktiḥ, vākśaktiḥ, vadantiḥ, nigadaḥ, nigādaḥ, vyāhāraḥ, vyāhṛtiḥ, vacanam, vādaḥ, tāpaḥ, abhilāpaḥ, lapitam, lapanam, bhaṇitiḥ, bhāratī, sarasvatī, rādhanā, kāsūḥ   

mukhanirgataḥ sārthakaḥ dhvanisamūhaḥ।

bhāṣā samparkasya mādhyamam ।

vad

avadhū   

mantroccāraṇena bhūtābādhāpanayanānukūlaḥ vyāpāraḥ।

māntrikaḥ taṃ puruṣam avadhūnoti।

vad

avadhībhāṣā   

avadhe saṃlāpitā bhāṣā।

gosvāmeḥ bahavaḥ racanāḥ avadhībhāṣāyāṃ santi।

vad

avajñā, avaman, upekṣ, avagaṇ, avadhīraya   

anyān prati anādarānukūlaḥ vyāpāraḥ।

saḥ māṃ samārohe avajñāsīt।

vad

niṣkāsaya, utsāraya, niḥsāraya, niras, nirdhū, niryāpaya, nirvad, nirvāsaya, uccāṭaya, samutpāṭaya, samudīraya, cālaya, samudvāsaya, avarudh, udākṛ, utkālaya, uddhū, tyājaya, nāśaya, vipravāsaya, vivāsaya, samākṣip, vyaparopaya, vyas, saṃcālaya, sañcālaya, nirvivah, nirhan, nirhṛ, dālaya, nistyaj, udas, utkliś, apacyu, avahan, aparudh, udaj, udvas, ji, niṣkṛ, parinirhan, parivṛj, prāmarjaya, vitathīkṛ, viropaya   

balāt sthānatyāgapreraṇānukūlaḥ vyāpāraḥ।

rājīvaḥ dvāri tiṣṭhantaṃ śvānaṃ nirakāsayat।

vad

tālaḥ, tāladrumaḥ, patrī, dīrghaskandhaḥ, dhvajadrumaḥ, vṛkṣarājaḥ, madhurasaḥ, madāḍhyaḥ, dīrghapādapaḥ, cirāyuḥ, tarurājaḥ, dīrghapatraḥ, gucchapatraḥ, āsavadruḥ, lekhyapatraḥ, mahonnataḥ   

sthāṇuvat śākhāvihīnaḥ dīrghaparṇayuktaḥ vṛkṣaḥ।

saḥ tālāt tālajataruṇatoyam udgṛhṇāti।

vad

avadhiḥ, antaram   

niyataḥ kālaḥ।

ghaṭikācatuṣṭayātmake avadhau kāryasya samāpanaṃ kartavyam।

vad

vadhūḥ   

sā strī yasyāḥ vivāhādanantaraṃ bahukālaḥ na vyatītaḥ।

vadhūḥ patigṛhaṃ gacchati।

vad

dhāraṇā, saṃkalpanā, avadhāraṇā   

kasminnapi viṣaye manasi udbhūtaṃ matam।

taṃ prati mama dhāraṇā ayogyā āsīt।

vad

vyavadhānam, antarddhā, antarddhiḥ, vyavadhiḥ, apavāraṇam, tirodhānam   

sā bādhā yayā purataḥ vastu draṣṭuṃ na śakyate।

rāmaḥ vālinaṃ vṛkṣasya vyavadhānaṃ kṛtvā jaghāna।

vad

paurva, pūrvadiśya, prāñc   

pūrvadiksambandhī।

bhāratasya paurvaḥ prāntaḥ kṛṣyarthe upayuktaḥ asti।

vad

prativac, pratibhāṣ, prativad, pratibrū, vyāhṛ, pratibhaṇ, pratijalp   

praśnādīnāṃ prativacanānukūlaḥ vyāpāraḥ।

sohanaḥ mama praśnaṃ samyak pratyavocat।

vad

snuṣā, putravadhūḥ   

putrasya vadhūḥ।

sītā kausalyāyāḥ snuṣā āsīt।

vad

sadā, nityam, sarvadā, pratikṣaṇam, sarvaśaḥ, sarvakālam, śaśvat, sadam, āpradivam, pradivaḥ, śaśvat, sanāt, aharniśam, pratyaham   

kṣaṇe kṣaṇe।

sarvaiḥ sadā satyam eva vaktavyam।

vad

vajram, kuliśam, bhaduram, paviḥ, śatakoṭiḥ, svaruḥ, śambaḥ, dambholiḥ, aśaniḥ, kulīśam, bhidiram, bhiduḥ, svarus, sambaḥ, saṃvaḥ, aśanī, vajrāṃśaniḥ, jambhāriḥ, tridaśāyudham, śatadhāram, śatāram, āpotram, akṣajam, girikaṇṭakaḥ, gauḥ, abhrottham, meghabhūtiḥ, girijvaraḥ, jāmbaviḥ, dambhaḥ, bhidraḥ, ambujam, hlādinī, didyut, nemiḥ, hetiḥ, namaḥ. sṛkaḥ, vṛkaḥ, vadhaḥ, arkaḥ, kutasaḥ , kuliśaḥ, tujaḥ, tigmam, meniḥ, svadhitiḥ sāyakaḥ, paraśuḥ   

indrasya pradhānaṃ śastram।

ekadā indreṇa hanumān vajreṇa prahṛtaḥ।

vad

karṇe jap, parivad, apavad   

parasparabhedoddaśena anyasya viṣaye anyena saha apabhāṣaṇānukūlaḥ vyāpāraḥ।

rāmaḥ śyāmasya viṣaye svāminaḥ karṇe japati।

vad

bhojanam, jagdhaḥ, jemanam, lepaḥ, āhāraḥ, nighasaḥ, nyādaḥ, jamanam, vighasaḥ, abhyavahāraḥ, pratyavasānam, aśanam, svadanam, nigaraḥ   

adanasya kriyā।

bhojanāt anantaraṃ saḥ viśrāmārthe gataḥ।

vad

svadeśabhaktaḥ, svadeśahitaparāyaṇaḥ, svadeśābhimānī   

yaḥ svadeśasya unnatim icchati tadarthaṃ prayatate ca।

ājādabhagatasiṃhādayaḥ svadeśabhaktāḥ svatantratāyai ātmabalidānam akurvan।

vad

vaśīkaraṇavidyā, vaśīkaraṇam, vaśakriyā, saṃvadanam   

vidyāviśeṣaḥ, maṇimantrauṣadhairāyattīkaraṇam yena janāḥ prayoktuḥ icchayā kāryaṃ karoti;

tāntrikeṇa vaśīkaraṇavidyāṃ prayujya mohanaṃ svasya vaśīkṛtaḥ

vad

garbhapātaḥ, bhrūṇahatyā, bhrūṇavadhaḥ, garbhasaṃsravaṇam, garbhasamplavaḥ   

garbhasya sampūrṇavṛddheḥ pūrvameva tasya patanam।

sopānāt patanena snuṣāyāḥ garbhapātaḥ abhavat।

vad

bharataḥ, sarvadamanaḥ, śākuntaleyaḥ   

śakuntalāyāḥ garbhāt jātaḥ rājñaḥ duṣyantasya putraḥ।

bharataḥ bālyāvasthāyāṃ siṃhaśiśunā saha akhelat।

vad

khanitram, khātram, ākhanikaḥ, ākhanaḥ, ākhanam, ākhaḥ, avadāraṇam, godāraṇam, stambaghnaḥ, ṭaṅkaḥ, ṭaṅgaḥ, viśikhā   

astraviśeṣaḥ, lohasya khananasādhanadravyam।

vṛkṣasya ropaṇārthe khanitrena bhūmim khanayati kṛṣīvalaḥ।

vad

govadhaḥ, gohatyā   

goḥ hatyā।

hindūdharmānusāreṇa govadhaḥ iti mahāpāpam asti।

vad

vadhūyānam, vadhūsaṃyānam   

striṇāṃ vāhanaṃ yaṃ kāhārakāḥ vāhayanti।

kāhārakāḥ vadhūyānam udyāne sthāpayitvā viśrāmyanti।

vad

kalahāya, kalahaṃ kṛ, vivad   

vivādajanakaḥ vitaṇḍanānukūlavyāpāraḥ।

bhūmivibhājanasamaye śyāmaḥ bhrātṛbhiḥ saha kalahāyate।

vad

vadhaḥ, hatyā, hananam, ghātaḥ, māraṇam, nāśaḥ, niṣūdanam, hiṃsā, hiṃsanam, ālambhaḥ, viśasanam, vyāpādanam, pramāpaṇam, nibarhaṇam, nikāraṇam, viśāraṇam, pravāsanam, parāsanam, saṃjñapanam, nirgranthanam, nistarhaṇam, kṣaṇanam, parivarjanam, nirvāpaṇam, pramathanam, krathanam, ujjāsanam, piñjaḥ, viśaraḥ, unmāthaḥ   

saṃharaṇam yasmin prāṇaiḥ viyujyate।

duṣṭānāṃ vadhaṃ kartuṃ īśvaraḥ avatarati।

vad

vatsaraḥ, varṣaḥ, saṃvatsaraḥ, parivatsaraḥ, abdaḥ, samā, samāḥ, saṃvad, hāyanaḥ, variṣam, kālagranthiḥ, ṛtuvṛttiḥ, māsamānaḥ, yugāṃśakaḥ, śarad, śaradā   

sarveṣām ṛtunāṃ parivartaḥ dvādaśa-māsayuktaḥ yugasya aṃśabhūtaḥ kālaḥ।

agrime vatsare bhārate vaiśvika-krīḍā-mahotsavaḥ bhaviṣyati।

vad

āragvadhaḥ, rājavṛkṣaḥ, sampākaḥ, caturaṅgulaḥ, ārevataḥ, vyādhighātaḥ, kṛtamālaḥ, suvarṇakaḥ, manthānaḥ, rocanaḥ, dīrghaphalaḥ, nṛpadṛmaḥ, himapuṣpaḥ, rājatanuḥ, kaṇḍughnaḥ, jvarāntakaḥ, arujaḥ, svarṇapuṣpam, svarṇadruḥ, kuṣṭhasudanaḥ, karṇābharaṇakaḥ, mahārājadrumaḥ, karṇikāraḥ, svarṇāṅgaḥ, pragrahaḥ, śampākaḥ, śampātaḥ   

vṛkṣaviśeṣaḥ yasya māṣaḥ dīrghaḥ asti।

āragvadhasya puṣpāṇi pītāni tathā ca parṇāni śirīṣasadṛśāni bhavanti।

vad

avagam, budh, avabudh, vid, jñā, grah, parigrah, upalabh, ūh, vibhāvaya, avadhāraya   

kañcana viṣayaṃ buddhau dhāraṇānukūlaḥ vyāpāraḥ।

avabodhanāntaramapi saḥ idaṃ kūṭaṃ na avāgamat।

vad

svīkṛ, aṅgīkṛ, urarīkṛ, saṃvijñā, samman, abhijñā, abhyupagam, abhyupe, pratigṝ, pratisaṃvad   

anyeṣāṃ matānām anumodanānukūlaḥ vyāpāraḥ।

ahaṃ bhavatāṃ mataṃ svīkaromi।

vad

vaśīkaraṇam, saṃvadanam, saṃvadanā, vaśakriyā   

maṇimantrauṣadhairāyattīkaraṇam।

tāntrikaḥ vaśīkaraṇena rāmaṃ svavaśam akarot।

vad

kinnaraḥ, kimpuruṣaḥ, mayuḥ, turaṅgavadanaḥ, aśvamukhaḥ, gītamodī, hariṇanartakaḥ   

devayoniḥ yasya mukham aśvasadṛśam।

kinnaraḥ nṛtyagāyanena devatān rañjayati।

vad

pādatrāṇam, pādapā, pādukā, pādū, vadhryaḥ   

caraṇabandhārthe paṭṭakayuktā carmanirmitā pādukā yasyāḥ paridhānena api pārṣṇiḥ anāvṛtā vartate।

adhunā ubhe api mama pādatrāṇe chinne staḥ।

vad

anavadhānatā, pramādaḥ, anapekṣā, asāvadhānatā   

anavadhānasya avasthā।

anavadhānatayā mārgalaṅghanasamaye mohanaḥ yānena āghātitaḥ।

vad

klībaḥ, tṛtīyaprakṛtiḥ, apuṃs, uḍumbaraḥ, tūbarakaḥ, pṛṣṭhaśṛṅgī, varṣavaraḥ, paṇḍraḥ, muṣkaśūnyaḥ, paṇḍrakaḥ, strīsvabhāvaḥ, vṛṣāṅkaḥ, dharṣavaraḥ, ṣaṇḍhaḥ, dharṣaḥ, vadhrikā, akṣataḥ, akṣatam, prakṛtiḥ   

saḥ janaḥ yaḥ na strī na ca pumān।

adyatanakāle klībāḥ api rājanītau bhāgaṃ gṛhṇanti।

vad

kiṃvadantī, janapravādaḥ, pravādaḥ, janaśrutiḥ, upaśrutiḥ, upakarṇikā, pravādaḥ, janapravādaḥ, nirvādaḥ, lokavādaḥ, śrutiḥ   

lokeṣu vartamānā ayathārthā vārtā।

kadācit kiṃvadantī janānāṃ manasi bhayam utpādayati।

vad

vicchedaḥ, sambhedaḥ, khaṇḍaḥ, vibhaṅgaḥ, bhaṅgaḥ, khaḍaḥ, prabhaṅgaḥ, nirdalanam, vicaṭanam, āmoṭanam, dalanam, bhidyam, sambhedanam, avadaraṇam, daraṇam   

khaṇḍanasya kriyā।

rāmaḥ śivadhanuṣaḥ vicchedaṃ cakāra।

vad

dohanam, avadoham   

gomahiṣyādeḥ stanāt dugdhaniḥsāraṇam।

kṛṣakaḥ prātaḥ paśūnāṃ dohanaṃ karoti।

vad

devadāru, śakrapādapaḥ, paribhadrakaḥ, bhadradāru, drukilimam, pītudāru, dāru, dārukam, snigdhadāru, amaradāru, śivadāru, śāmbhavam, bhūtahāri, bhavadāru, bhadravat, indradāru, mastadāru, surabhūruhaḥ, surāvham, devakāṣṭham   

vṛkṣaviśeṣaḥ- yasmāt tailaṃ prāpyate।

devadāruṇaḥ kāṣṭham dṛḍham asti।

vad

devadāsī   

devatāyai samarpitā sā strī yā mandire dāsīrūpeṇa nartakīrūpeṇa vā nivasati।

asmin mandire naikāḥ devadāsyaḥ santi।

vad

klībatā, klībatvam, klaibyam, nirvīryatā, puṃstvadoṣaḥ   

puruṣeṣu jāyamānaḥ ekaḥ vyādhiviśeṣaḥ yasmin puruṣaḥ sambhogārthaṃ santānotpattau ca asamarthaḥ bhavati।

mohanalālamahodayaḥ durghaṭanāyāḥ anantaraṃ klībatayā grastaḥ।

vad

nirṇī, niści, sādhaya, siddhīkṛ, niṣpādaya, parikalpaya, vyavaso, avadhāraṇaṃ kṛ, nirdhāraṇaṃ kṛ, sampradhāraṇaṃ kṛ, samīkṛ   

kasyāpi praśnasya vivādasya vā samādhānānukūlaḥ vyāpāraḥ।

pitāmahaḥ vivādaṃ nirṇayati।

vad

mārgadarśakaḥ, pathadarśakaḥ, upadeśakaḥ, nirdeśakaḥ, nāyakaḥ, pragrahaḥ, mārgopadik, nirdeṣṭā, adhvadarśī, saṃcārayitā, nirṇetā, dhūrṣad, uddeśakaḥ, padavāyaḥ, ādeśakaḥ, prajñātā, mukhyaḥ, vicārakaḥ, vināyakaḥ, vinetā, voḍhā   

yaḥ mārgaṃ darśayati।

vayam ekaṃ kuśalaṃ mārgadarśakam anusarantaḥ agre agacchāma।

vad

udāratā, udārabhāvaḥ, audāryam, dānaśīlatvam, vadānyatā, udārātmatā, mahānubhāvatā, mahānubhāvatvam   

udārasya avasthā bhāvaḥ vā।

seṭhakaroḍīmalamahodayaḥ svasya udāratāyāḥ kṛte prasiddhaḥ asti।

vad

sīmā, maryādā, āghāṭaḥ, avadhiḥ, maryā, aṇī, āṇiḥ, aṇiḥ, āyattiḥ, antaḥ, antakaḥ, parisīmā, sīmantaḥ, pāliḥ, velā, avacchedaḥ, paricchedaḥ   

kasyāpi pradeśasya vastunaḥ vā vistārasya antimā rekhā।

bhāratadeśasya sīmni sainikāḥ santi।

vad

vidīrṇa, avadārita, vidārita, avadīrṇa   

yaḥ jīrṇaḥ।

dāridryāt rītā vidīrṇāni vastrāṇi dhārayati।

vad

karṇe jap, karṇam upajap, karṇe kathaya, karṇe vad   

nīcaiḥ svareṇa karṇe bhāṣaṇānukūlaḥ vyāpāraḥ।

videśinīṃ snuṣāṃ dṛṣṭvā janāḥ karṇe ajapan।

vad

bhūmadhyarekhā, nirakṣaḥ, viṣuvadvṛttam, vyakṣaḥ, bhūvārāhavṛttam, viṣṇugolaḥ, viṣuvanmaṇḍalam, viṣuvadvalayam   

pṛthivyāḥ madhyabhāgaṃ sūcayantī ekā kālpanikī rekhā yasyāḥ dvau dhruvau samāne antare staḥ।

bhūmadhyarekhāṃ parītaḥ adhikā uṣṇatā bhavati।

vad

kukkuṭī, kukkuṭavadhūḥ, kukkuṭapakṣiṇī, grāmyakukkuṭī   

kukkuṭajātīyā strīpakṣiṇī।

kukkuṭyaḥ aṇḍāni svāsthyārtham atīva upayuktāni।

vad

lālā, syandinī, lasikā, drāvikā, sṛṇīkā, sṛṇikā, syandanī, lāsaḥ, āsyāsavaḥ, mukhasrāvaḥ, vadanāsavaḥ, vaktrāsavaḥ   

mukhāt sravamāṇaḥ rasaḥ।

putrasya mukhāt sravamāṇāṃ lālāṃ mātā punaḥ punaḥ proñchayati।

vad

antardhā, vyavadhā, antardhiḥ, apavāraṇam, apidhānam, tirodhānam, pidhānam, ācchādanam, antaram   

antardhānakriyā yat viśeṣataḥ devatādīnām bhavati।

bhagavān bhaktāya varaṃ datvā tirodhānaṃ kṛtavān।

vad

vadhakaḥ, ghātakaḥ, daṇḍapāśikaḥ, vadhyāpuruṣaḥ, vadhakarmādhikārī   

udbandhanadaṇḍasya prāptṝṇām udbandhaṃ yaḥ karoti saḥ।

prāptamṛtyudaṇḍasya puruṣasya vadhakaḥ udbandhanam akarot।

vad

vadhya, hanya   

vadhamarhyati;

rāṣṭradrohī vadhyaḥ asti।

vad

ghātakaḥ, mārakaḥ, ghātī, jīvāntakaḥ, vadhakaḥ, vṛkatiḥ, ātatāyī, unmāthaḥ, śiriḥ, hantā   

yaḥ hanti।

ghātakāya dehāntadaṇḍaṃ dattam।

vad

sthiranidhiḥ, sāvadhi-nikṣepa-lekhā   

yad dhanaṃ niścitaṃ kālaṃ yāvat vittakoṣe sthāpyate।

bhaviṣyakālasya dhanasambaddhāyai surakṣāyai janāḥ sthiranidhiṃ sthāpayanti।

vad

nṛhatyā, manuṣyavadhaḥ   

kenāpi uddeśena manuṣyahananam।

nṛhatyā iti nindanīyaḥ aparādhaḥ asti।

vad

paraśuḥ, paraśvadhaḥ, chidiḥ, vṛkṣabhid, vṛkṣabhedī, svadhitiḥ   

śastraviśeṣaḥ laghukuṭhāraḥ।

saḥ paraśunā kāṣṭhaṃ chinatti।

vad

kiṃvadantī, janaśrutiḥ, lokakathā   

tādṛśaḥ lokavādaḥ yasya satyāsatyaviṣaye kimapi pramāṇaṃ nāsti।

asya mandirasya viṣaye naikāḥ kiṃvadantyaḥ prasiddhāḥ santi।

vad

svaharaṇam, sarvasvadaṇḍaḥ, sarvasvāpahāraḥ   

adhikāriṇā sarvakāreṇa vā daṇḍarūpeṇa kasyacit aparādhinaḥ sampatteḥ grahaṇam।

lālāmahodayena svaharaṇasya daṇḍaḥ prāptaḥ।

vad

vicchid, vihan, anuvihan, ucchid, uparudh, upasaṃhṛ, parihā, pratibandh, pratyavahṛ, pratyūh, bhid, vyavadhā   

kramasya bhaṅgānukūlaḥ vyāpāraḥ।

sañcālanaṃ kurvāṇānāṃ sainikānāṃ kramaḥ vyacchinat।

vad

sāvadhānatā, dakṣatā, avadhānam, avekṣā   

sāvadhānasya avasthā bhāvaḥ vā।

sāvadhānatayā mārgaḥ laṅghanīyaḥ।

vad

bhadratā, anukūlatā, ṛtiḥ, ṛddhiḥ, kantvam, nandā, bhāgyavattā, bhāgyasampad, suṣṭhutā, subhagatvam, susvadhā, saubhāgyavattā, saubhāgyavattvam, sphītatā, śriyā, śrīyā   

sukhadāyikā sampannā ca avasthā।

gṛhe bhadratā asti।

vad

vyādhaḥ, lubdhakaḥ, mṛgavadhājīvaḥ, mṛgayuḥ, mṛgāvin, drohāṭaḥ, mṛgajīvanaḥ, mṛgapāṃśunaḥ   

jātīviśeṣaḥ- mṛgahiṃsakajātiḥ।

vyādhaḥ vṛkṣasya adhastāt saṃyojayitvā gopayati।

vad

śṛṅkhalā, pāśaḥ, nigaḍaḥ, lohakaṭakaḥ, lohapāśaḥ, lauhabandham, lohaśṛṅkhalaḥ, vīvadhā, anduḥ, andūḥ, andukaḥ, lauhanigaḍaḥ   

dhātoḥ anyonyeṣu saṃyuktānāṃ kuṇḍalānāṃ mālā।

paśuḥ rajvā vā śṛṅkhalayā vā badhyate।

vad

rakṣ, anurakṣ, abhirakṣ, anupālaya, pratirakṣ, virakṣ, saṃrakṣ, parirakṣ, sāvadhānībhū   

niyamanānukūlaḥ vyāpāraḥ।

durguṇebhyaḥ trātuṃ aham ātmānam arakṣam।

vad

cit, jāgṛ, prabudh, sāvadhānībhū   

cetasaḥ apramattānukūlaḥ vyāpāraḥ।

ahaṃ bhavadbhyaḥ pratyādeśaṃ dadāmi yat bhavān cetatu iti।

vad

vyavadhānam   

vibhāgādīn kartuṃ nirmitā bhittikā।

janāḥ vyavadhānam ullaṅghayitvā udyāne āgatāḥ।

vad

nirdoṣa, doṣahīna, doṣarahita, pāpaśūnya, amala, anāmaya, adoṣa, anavadya, apadoṣa, amalina, avyalīka, niṣkalaṅka   

doṣāt vihīnaḥ।

adyayāvat mayā nirdoṣaḥ puruṣaḥ na dṛṣṭaḥ।

vad

abhinirdiś, pradiś, nirdiś, upadiś, apadiś, nidarśaya, pradarśaya, vinirdiś, avadyotaya, lakṣaya, ādiś, upādiś, ākṣip   

kāryaviśeṣasya vā vastuviśeṣasya vā jñāpanānukūlaḥ vyāpāraḥ।

mātā mahyaṃ ākāśe dhruvasya sthitim abhinirdiśati।

vad

vibhāvaya, budha, avadhāraya, avagam, grah, ālokaya, jñā   

kiṃcanaviṣayakaḥ matyanukūlaḥ vyāpāraḥ।

ahaṃ taṃ sādhu iti vyabhāvayāmi।

vad

abhinirdiś, niści, avadhāraya, prakalpaya, parikalpaya   

sthānasamayādīnāṃ niścayānukūlaḥ vyāpāraḥ।

saḥ dvivādane āgamanaṃ abhinirdiśati।

vad

ketakaḥ, ketakī, indukalikā, tīkṣṇapuṣpā, dīrghapatraḥ, pāṃsukā, amarapuṣpaḥ, amarapuṣpakaḥ, kaṇṭadalā, kanakaketakī, kanakapuṣpī, droṇīdalaḥ, karatṛṇam, krakacacchadaḥ, gandhapuṣpaḥ, dalapuṣpā, dalapuṣpī, cakṣuṣyaḥ, cāmarapuṣpaḥ, chinnaruhā, jambālaḥ, jambulaḥ, dhūlipuṣpikā, nṛpapriyā, pharendraḥ, valīnakaḥ, viphalaḥ, vyañjanaḥ, śivadviṣṭā, sugandhinī, sūcipuṣpaḥ, sūcikā, strībhūṣaṇam, sthiragandhaḥ, svarṇaketakī, hanīlaḥ, halīmaḥ, hemaketakī, haimaḥ   

kṣupaviśeṣaḥ- yasya savāsikasya puṣpasya patrāṇi krakacasya iva tīkṣṇāni santi।

adhunā udyānasthasya ketakasya puṣpaṃ vikasati।

vad

avaman, apaman, avajñā, tiraskṛ, adhikṣip, nikṛ, atibrū, paribhū, nind, garh, garhaya, kutsaya, laghūkṛ, ākṣip, kṣip, upakṣip, samākṣip, ādharṣaya, avadharṣaya, sampradharṣaya, durjanīkṛ, kātkṛ, prastobhaya, laṅghaya, vipralambhaya   

mānabhaṅgānukūlaḥ vyāpāraḥ।

saḥ śyālam atīva avāmanyata।

vad

kathaya, brū, vac, vad, varṇaya, ācakṣ, cakṣ, śaṃs, ākhyā, khyā, śrāvaya, nigad, gad, parigad, nivedaya, vyāhṛ, udāhṛ, hṛ, abhidhā, nirūpaya, abhivac, āśaṃs, āśrāvaya, upavarṇaya, nibodhaya, pratibhāṣ, prabrū, prabhāṣ, pravac, nirvac, pravad, bhāṣ, pracakṣ, prajalp, pratipravac, vicakṣ   

vākyaprabandhena anyeṣāṃ jñāpanānukūlaḥ vyāpāraḥ।

saḥ ātmavṛttāntaṃ kathayati।

vad

vyapadiś, abhidhā, vyākhyā, nirdiś, abhivad, ācakṣ, paricakṣ, upadiś, ābhāṣ, parikathaya, paripaṭh, prakīrtaya, pracakṣ, pratibhāṣ, prabrū, prabhāṣ, pravad, pravicakṣ, bhāṣ   

janeṣu viśiṣṭena nāmnā khyātānukūlaḥ vyāpāraḥ।

janāḥ gāndhīmahodayaṃ bāpū iti nāmnā vyapadiśanti।

vad

bhāṣ, sambhāṣ, saṃbhāṣ, lap, ālap, saṃlap, saṃvad, sammantraya   

uktipratyuktiyuktaḥ bandhubhiḥ saha bhāṣaṇānukūlaḥ vyāpāraḥ।

idānīṃ śīlā mayā saha na bhāṣate।

vad

tiraskṛ, nirākṛ, dhikkṛ, pratyākhyā, avadhīraya, niravadhū, sāvajñaṃ pratyādiś, pratyanujñā, garh   

anyaṃ tucchaṃ matvā niṣkāsanānukūlaḥ vyāpāraḥ।

saḥ daridraṃ bhrātaraṃ tiraskaroti।

vad

navadurgā   

durgāyāḥ nava rūpāṇi।

navarātriṣu navadurgāyāḥ upāsanāṃ kurvanti।

vad

svāhā, agnāyī, hutabhukpriyā, dviṭhaḥ, analapriyā, vahnivadhūḥ   

agnibhāryā।

dharmagrantheṣu svāhā iti agnipatnī asti iti varṇanaṃ prāpyate।

vad

spaṣṭa, avadāta, aviśuddha, abhrama, avispaṣṭa, āvyakta, iddha   

yad svacchatayā na avagamyate।

asya padyasya anvarthaḥ spaṣṭaḥ nāsti।

vad

pṛśniparṇikā, pṛśniparṇī, pṛthakparṇī, citraparṇī, aṅghrivallikā, kroṣṭuvinnā, siṃhapucchī, kalaśiḥ, dhāvaniḥ, guhā, pṛṣṇiparṇī, lāṅgalī, kroṣṭupucchikā, pūrṇaparṇī, kalaśī, kroṣṭukamekhalā, dīrghā, śṛgālavṛntā, triparṇī, siṃhapucchikā, siṃhapuṣpī, dīrghapatrā, atiguhā, ghṛṣṭhilā, citraparṇikā, mahāguhā, śṛgālavinnā, dhamanī, dhāmanī, mekhalā, lāṅgūlikā, lāṅgūlī, lāṅgūlikī, pṛṣṭiparṇī, pṛṣṭaparṇī, dīrghaparṇī, aṅghriparṇī, dhāvanī, kharagandhā, kharagandhanibhā, gorakṣataṇḍulā, catuṣphalā, jhaṣā, dhāvanī, nāgabalā, mahāgandhā, mahāpattrā, mahāśākhā, mahodayā, viśvadevā, viśvedevā, hrasvagavedhukā, ghaṇṭā, ghoṇṭāphala, gorakṣataṇḍula, gāṅgerukī, golomikā, dyutilā, brahmaparṇī, rasālihā, śīrṇanālā, sumūlā, khagaśatruḥ, śvapuccham   

auṣadhopayogī latāviśeṣaḥ।

pṛśniparṇikāyāḥ śvetavarṇayuktaṃ vartulākārarūpaṃ puṣpaṃ bhavati।

vad

anukṛ, anuhṛ, anugam, anusṛ, anvi, anuyā, anuvṛta, anuvidhā, anuvad, viḍambaya   

anyena sadṛśam ācaraṇānukūlaḥ vyāpāraḥ।

śyāmaḥ pitāmahasya anukaroti।

vad

dīvadamane   

bhāratasya ekaḥ kendraśāsitaḥ pradeśaḥ।

dīvadamanayoḥ janānāṃ bhojyaṃ gujarātasthajanānāṃ sadṛśam asti।

vad

mārgadarśanam, upadeśanam, nirdeśanam, adhvadarśanam   

kāṭhinyādeḥ nirgamanāya kasyāpi kāryādeḥ sampādanāya vā mārgasūcanāyāḥ kriyā।

śīlā mahataḥ viduṣaḥ mārgadarśanena svasya anusandhānaṃ karoti।

vad

māladīvadeśaḥ   

eśiyāmahādvīpasya dakṣiṇe ekaḥ dvīpyaḥ deśaḥ।

māladīvadeśe pravālāḥ dvīpāḥ antarbhūtāḥ santi।

vad

māladīvadeśīyaḥ   

māladīvadeśasya ādimaḥ nivāsī।

māladīvadeśīyāḥ atīva pariśramiṇaḥ bhavanti।

vad

māladīvadeśīya   

māladīvadeśena sambaddhaṃ māladīvadeśasya vā।

māladīvadeśīyeṣu dvīpeṣu pravālāḥ adhikataraṃ vartante।

vad

ginī-bisovadeśīya-pesauḥ   

ginī-bisovadeśe pracalitā mudrā।

ekasya ginī-bisovadeśīya-pesāḥ kati rupyakāṇāṃ tulyaḥ asti।

vad

sṛgālavadanaḥ   

ekaḥ asuraḥ।

sṛgālavadanasya varṇanaṃ purāṇeṣu vartate।

vad

jīvantī, jīvanī, jīvā, jīvanīyā, madhusravā, madhuḥ, sravā, payasvinī, jīvyā, jīvadā, jīvadātrī, śākaśreṣṭhā, jīvabhadrā, bhadrā, maṅgalyā, kṣudrajīvā, yaśasyā, śṛṅgāṭī, jīvadṛṣṭā, kāñjikā, śaśaśimbikā, supiṅgalā, madhuśvāsā, jīvavṛṣā, sukhaṅkarī, mṛgarāṭikā, jīvapatrī, jīvapuṣpā, jīvanī   

latāviśeṣaḥ।

jīvantī auṣadharūpeṇa upayujyate।

vad

śālavadanaḥ   

asuraviśeṣaḥ।

śālavadanasya varṇanaṃ purāṇeṣu asti।

vad

ghātaḥ, viśasanam, pramāthaḥ, niṣūdam, pramāpaṇam, halyā, vadhaḥ, hananam, ghātaḥ, māraṇam, nāśaḥ, hiṃsā-sanam, ālaṃbhaḥ, viśasanam   

ekasamayāvacchede janānāṃ krūrā hatyā।

asmin māse ātaṃkavādibhiḥ kopi ghātaḥ na kṛtaḥ।

vad

bhavadā   

kārtikeyasya ekā mātṛkā।

bhavadāyāḥ varṇanaṃ purāṇeṣu vartate।

vad

avadhyaḥ   

hantum anarhaḥ।

avadhyānāṃ paśūnāṃ baliṃ na dadyāt।

vad

avadhya   

yasya hananasya vidhānaṃ nāsti।

hindudharmānusāreṇa gauḥ avadhyaḥ paśuḥ।

vad

avadhya   

yaḥ kenāpi hantuṃ na śakyate।

kim ekopi jīvaḥ avadhyaḥ।

vad

avadhūta upaniṣad, avadhūta   

ekā upaniṣad।

avadhūta-upaniṣad yajurvedena sambandhitā।

vad

jñānī, yogī, tatvadarśī, antaḥprajñaḥ, ātmajñaḥ, ātmajñānī, siddhaḥ   

yaḥ ātmānaṃ jānāti।

mahantaḥ jñāninaḥ api bhagavataḥ darśanaṃ kāṅkṣanti।

vad

hatyā, vadhaḥ, ghātaḥ, sūdanaṃ, hiṃsā   

hananasya kriyā athavā bhāvaḥ।

kasyāpi hatyāyai dhairyam apekṣate।

vad

priyaṃvadaḥ   

pakṣīviśeṣaḥ yasya cañcuḥ pītā bhavati।

priyaṃvadasya vakṣaḥ kaṣṭhaḥ udaram ityādayaḥ śvetavarṇīyāḥ bhavanti।

vad

svadeśaśatruḥ, svadeśaghātakaḥ, rājadrohin, viśvāsaghātakaḥ   

yaḥ deśasya viruddhaṃ droham akarot।

satarkatayā svadeśaśatrūṇāṃ gūḍhayukteḥ upāyaṃ kartuṃ śakyate।

vad

saralaḥ, devadāruḥ   

ekaḥ sāṃvatsaraḥ vṛkṣaviśeṣaḥ।

saralasya komalebhyaḥ kāṣṭhebhyaḥ svīkṛtaṃ tailaṃ devadārutailam iti kathyate।

vad

somaḥ, candraḥ, śaśāṅkaḥ, induḥ, mayaṅkaḥ, kalānidhiḥ, kalānāthaḥ, kalādharaḥ, himāṃśuḥ, candramāḥ, kumudabāndhavaḥ, vidhuḥ, sudhāṃśuḥ, śubhrāṃśuḥ, oṣadhīśaḥ, niśāpatiḥ, abjaḥ, jaivātṛkaḥ, somaḥ, glauḥ, mṛgāṅkaḥ, dvijarājaḥ, śaśadharaḥ, nakṣatreśaḥ, kṣapākaraḥ, doṣākaraḥ, niśīthinīnāthaḥ, śarvarīśaḥ, eṇāṅkaḥ, śītaraśmiḥ, samudranavanītaḥ, sārasaḥ, śvetavāhanaḥ, nakṣatranāmiḥ, uḍupaḥ, sudhāsūtiḥ, tithipraṇīḥ, amatiḥ, candiraḥ, citrāṭīraḥ, pakṣadharaḥ, rohiṇīśaḥ, atrinetrajaḥ, pakṣajaḥ, sindhujanmā, daśāśvaḥ, māḥ, tārāpīḍaḥ, niśāmaṇiḥ, mṛgalāñchanaḥ, darśavipat, chāyāmṛgadharaḥ, grahanemiḥ, dākṣāyaṇīpati, lakṣmīsahajaḥ, sudhākaraḥ, sudhādhāraḥ, śītabhānuḥ, tamoharaḥ, tuśārakiraṇaḥ, pariḥ, himadyutiḥ, dvijapatiḥ, viśvapsā, amṛtadīdhitiḥ, hariṇāṅkaḥ, rohiṇīpatiḥ, sindhunandanaḥ, tamonut, eṇatilakaḥ, kumudeśaḥ, kṣīrodanandanaḥ, kāntaḥ, kalāvān, yāminījatiḥ, sijraḥ, mṛgapipluḥ, sudhānidhiḥ, tuṅgī, pakṣajanmā, abdhīnavanītakaḥ, pīyūṣamahāḥ, śītamarīciḥ, śītalaḥ, trinetracūḍāmaṇiḥ, atrinetrabhūḥ, sudhāṅgaḥ, parijñāḥ, sudhāṅgaḥ, valakṣaguḥ, tuṅgīpatiḥ, yajvanāmpatiḥ, parvvadhiḥ, kleduḥ, jayantaḥ, tapasaḥ, khacamasaḥ, vikasaḥ, daśavājī, śvetavājī, amṛtasūḥ, kaumudīpatiḥ, kumudinīpatiḥ, bhūpatiḥ, dakṣajāpatiḥ, oṣadhīpatiḥ, kalābhṛt, śaśabhṛt, eṇabhṛt, chāyābhṛt, atridṛgjaḥ, niśāratnam, niśākaraḥ, amṛtaḥ, śvetadyutiḥ   

devatāviśeṣaḥ;

patitaṃ somamālokya brahmā lokapitāmahaḥ[śa.ka]

vad

mukham, vaktram, āsyam, vadanam, tuṇḍam, ānanam, lapanam   

śarīrāvayavaviśeṣaḥ, khanati vidārayati annādikamanena;

mukhaṃ vimucya śvasitasya dhārayā vṛthaiva nāsāpathadhāvanaśramaḥ [nai.9.44]

vad

vadhaḥ, hatyā   

ākasmikena śastrāghātena kasya api prāṇānam apaharaṇam।

indirā gāndhīmahodayāyāḥ vadhaḥ tasyāḥ saṃrakṣakeṇa eva kṛtā।

vad

priyaṃvadā   

śakuntalāyāḥ sakhī।

priyaṃvadāyāḥ varṇanaṃ dharmagrantheṣu asti।

vad

priyaṃvadā   

vṛttaviśeṣaḥ।

priyaṃvadāyāḥ pratyekasmin caraṇe nagaṇaḥ magaṇaḥ jagaṇaḥ tathā ragaṇaḥ bhavati।

vad

jāgarukatā, sāvadhānatā   

jāgarukasya avasthā।

janeṣu śikṣāyāḥ jāgarukatāyāḥ pracāraḥ kartavyaḥ।

vad

vadānya   

udāraḥ dātā।

karṇaḥ vadānyeṣu puruṣeṣu gaṇyate।

vad

vadhyadiṇḍimaḥ, vadhadiṇḍimam   

prācīne kāle vartamānaḥ paṭahaviśeṣaḥ yaḥ prāṇadaṇḍasya anuṣṭhānasamaye vādayate sma।

vadhyadiṇḍimasya dhvaniṃ śrutvā janeṣu bhayam utpadyate sma।

vad

viśvadhārā   

paurāṇikī nadī।

viśvadhārāyāḥ varṇanaṃ naikeṣu dhārmikeṣu grantheṣu prāpyate।

vad

viśvadhenuḥ   

paurāṇikaḥ ṛṣiviśeṣaḥ।

viśvadhenoḥ varṇanaṃ purāṇeṣu prāpyate।

vad

śaśivadanā   

varṇavṛttaviśeṣaḥ।

śaśivadanāyāḥ pratyekasmin caraṇe nagaṇaḥ yagaṇaśca bhavati।

vad

induvadanā   

chandoviśeṣaḥ।

induvadanāyāḥ pratyekasmin caraṇe bhagaṇaḥ jagaṇaḥ sagaṇaḥ nagaṇaḥ dvau guruśca bhavanti।

vad

devadālī, turaṅgikā, jīmūtakaḥ, kaṇṭaphalā, garā, garī, veṇī, mahākoṣaphalā, kaṭphalā, ghorā, kadambī, viṣahā, karkaṭī, sāramūṣikā, vṛntakoṣā, dālī, romaśapatrikā, kuraṅgikā, sutarkārī, devatāḍaḥ   

kośātakyāḥ iva latāprakāraḥ।

atra sarvatra devadālī asti।

vad

gṛham, gṛhavad   

tad sthānaṃ yad atiparicitam asti।

prayāgaḥ matkṛte gṛham eva asti।

vad

nāgabalā, gāṅgerukī, hrasvagavedhukā, gāṅgeruhī, gorakṣataṇḍulā, bhadrodanī, kharagandhā, catuḥpalā, mahodayā, mahāpatrā, mahāśākhā, mahāphalā, viśvadevā, aniṣṭā, devadaṇḍā, mahāgandhā, ghaṇṭā   

auṣadhīyaḥ kṣupaviśeṣaḥ।

nāgabalā puruṣasya kāmaśaktiṃ vardhayati।

vad

kāntimattā, atisundaratā, aticārutā, surūpatā, abhirāmatā, anavadyarūpatā   

saundaryasya atiśayatā।

muniḥ apsarasaḥ kāntimattāṃ dṛṣṭvā tapāt bhraṣṭaḥ।

vad

aparicchanna, asaṃvṛta, āviṣkṛta, ucchanna, nirvyavadhāna, vikośa, vivṛta, anāvṛta   

yad saṃvṛtam nāsti।

aparicchannāt dvārāt sā tasmin gṛhe yad kim api asti tat sarvaṃ draṣṭuṃ aśaknot।

vad

tiraskṛ, dhiḥkṛ, kṣip, bharts, bhas, praduṣ, kuts, vigarh, atibrū, apavad, abhitarjay, ātarjay, udākṛ, upavad, katth, kuṭṭ, jarc, nirvad, nipīy, nivac, parigarh, paribhāṣ, pratinind, pratipīy, vigai, saṃtarjay, saṃduṣay, samabhitarjay   

vinindādibhiḥ adhodarśanānukūlaḥ vyāpāraḥ।

tava duṣkṛtyaiḥ eva adhunā janāḥ tvaṃ tiraskurvanti।

vad

nirṇāyaka, niścāyaka, avacchedaka, avadhāraka   

kasyāpi viṣasya niścitiḥ yena bhavati।

aparādhasya nirṇāyakāni pramāṇāni etāni।

vad

avadīrṇa, āyuta, gālita, dravamāṇa, drāvita, druta, nirgalita   

yad dravarūpe parivartitam।

mātā avadīrṇena ghṛtena miṣṭānnaṃ pacati।

vad

avadhaḥ   

vadhasya abhāvaḥ।

tasya kāryakāle rājye avadhaḥ āsīt।

vad

avadhijñānam   

jainadharmānusāreṇa dṛṣṭipathāt api uttaratra vartamānānāṃ vastūnāṃ pratyakṣajñānam।

avadhijñānāt pūrvaṃ sāmānyāyāḥ sattāyāḥ bhramaḥ jāyate।

vad

priyaṃvadaḥ   

gandharvaviśeṣaḥ।

priyaṃvadasya varṇanaṃ purāṇeṣu prāpyate।

vad

avyavadhānam   

vyavadhānena vinā।

avyavadhānena kāryakramaḥ sampannaḥ।

vad

devadārutailam   

devadāroḥ arukṣasya kāṣṭhasya tailam।

devadārutailasya upayogaḥ vedanāṃ nivārayituṃ kriyate।

vad

aśvadūtaḥ   

aśvārūḍhaḥ sandeśavāhakaḥ।

dvārapālaḥ aśvadūtena saha rājānaṃ prati gacchati।

vad

aśvavadanaḥ   

ekaḥ prācīnaḥ deśaḥ।

aśvavadanasya ullekhaḥ saṃskṛtasāhitye dṛśyate।

vad

bhāṇḍavāhaḥ, vaivadhikaḥ   

yaḥ gṛhe gṛhe gatvā vastūni vikrīṇāti।

bhāṇḍavāhasya dhvaniṃ śrutvā bālakāḥ gṛhāt bahiḥ āgacchanti।

vad

śatāvadhānaḥ   

yaḥ ekasminneva samaye śatāni kāryāṇi kartuṃ śaknoti।

idānīntane kāle śatāvadhānāḥ na dṛśyante।

vad

viśvadevaḥ   

devatāviśeṣaḥ।

nāndīmukhaśrāddhe viśvadevaḥ pūjyate।

vad

svadhā   

dakṣasya kanyā।

svadhā pitṝṇāṃ patnī astīti manyate।

vad

vyavadhānam, avarodhaḥ   

kāṣṭhapāṣāṇādīnāṃ tāni vastūni yaiḥ āghātaḥ bhavati।

asmin mārge naikāni vyavadhānāni santi, sāvadhānatayā gacchatu।

vad

viṣuvadvṛttam, viṣuvanmaṇḍalam   

bhūmadhyarekhayā nirmitaṃ vṛttam।

viṣuvadvṛttasya vyāsārdhaṃ 6,378:137 ki:mī iti asti।

vad

kāryakālaḥ, avadhiḥ   

kasyacit adhikāriṇaḥ pratinidheḥ kṛte vā tasmin pade kāryaṃ kartuṃ niyojitaḥ niścitaḥ kālaḥ।

mukhyamantriṇaḥ kāryakālaḥ pañca varṣāṇi yāvat bhavati।

vad

saniyama, niyantrita, sāvadhāraṇa   

niyamaiḥ yuktaḥ।

saniyamaṃ lekhanaṃ manorañjakaṃ syāt eva iti nāsti।

vad

navoḍhā, navavivāhitā, vadhūḥ, navavarikā   

idānīmeva yasyāḥ vivāhaḥ jātaḥ।

navoḍhāyāḥ hatyāyāḥ kāraṇaṃ kanyādhanam iti kathyate।

vad

madhyāvadhi   

yaḥ avadheḥ prāk vartate।

asmākaṃ pradeśe madhyāvadhi nirvācanam asti।

vad

sarvadalīya   

sarveḥ dalaiḥ sāmūhikarūpeṇa yad kriyate।

vittamantriṇā sarvadalīyā sabhā āyojitā।

vad

sarvadalīya   

sarvaiḥ dalaiḥ sambaddhaḥ।

sarvadalīyaḥ nirṇayaḥ svīkṛtaḥ bhavet।

vad

pūrvadarśanaḥ   

ekaḥ puruṣaḥ ।

purāṇe pūrvadarśanasya varṇanaṃ vidyate

vad

pūrvadevikā   

pūrvabhārate sthitasya ekaḥ grāmaḥ ।

pāṇininā pūrvadevikā ullikhitā

vad

vāvadūkaḥ   

ekaḥ puruṣaḥ ।

vāvadūkaḥ kurvādigaṇapāṭhe varṇitaḥ

vad

viśvadharaḥ   

puruṣasya nāmaviśeṣaḥ ।

viviraṇapustikāyāṃ viśvadharasya varṇanaṃ prāpyate

vad

vedavadanam   

ekaṃ sthānam ।

vedavadanasya ullekhaḥ vivaraṇapustikāyām asti

vad

vaidyajīvadāsaḥ   

ekaḥ kaviḥ ।

vaidyajīvadāsasya ullekhaḥ vivaraṇapustikāyām asti

vad

vaiṣṇavadāsaḥ   

ekaḥ lekhakaḥ ।

vaiṣṇavadāsasya ullekhaḥ vivaraṇapustikāyām asti

vad

priyaṃvadaḥ   

ekaḥ kaviḥ ।

priyaṃvadasya ullekhaḥ kośe vartate

vad

śavadhānāḥ   

ekaḥ janasamudāyaḥ ।

śavadhānānām ullekhaḥ mārkaṇḍeyapurāṇe asti

vad

śāmbhavadevaḥ   

ekaḥ kaviḥ ।

śāmbhavadevasya ullekhaḥ vivaraṇapustikāyām asti

vad

vaiśvadevabalikarma   

ekā kriyā ।

vaiśvadevabalikarma iti nāmnau dvau kriye staḥ

vad

śivadattapuram   

pūrvasyāṃ diśi vartamānaḥ ekaḥ grāmaḥ ।

śivadattapurasya ullekhaḥ pāṇininā kṛtaḥ

vad

śivadayāluḥ   

bhagavadgītāyāḥ ṭīkāgranthasya ekaḥ lekhakaḥ ।

śivadayāloḥ ullekhaḥ koṣe asti

vad

śivadaśakam   

kṛtiviśeṣaḥ ।

śivadaśakam iti nāmake dve kṛtī vartete

vad

śivadāsadevaḥ   

ekaḥ kaviḥ ।

śivadāsadevasya ullekhaḥ koṣe asti

vad

śivadīkṣāṭīkā   

ekaḥ ṭīkāgranthaḥ ।

śivadīkṣāṭīkāyāḥ ullekhaḥ koṣe asti

vad

śivadīnaḥ   

ekaḥ kośakāraḥ ।

śivadīnasya ullekhaḥ vivaraṇapustikāyām asti

vad

śivadīnadāsaḥ   

ekaḥ jyotirvid ।

śivadīnadāsasya ullekhaḥ kośe asti

vad

śivadevaḥ   

rājñaḥ nāmaviśeṣaḥ ।

śivadevaḥ iti nāmakayoḥ dvayoḥ rājñoḥ varṇanaṃ vivaraṇapustikāyām asti

vad

śivadevaḥ   

ekaḥ vaiyākaraṇaḥ ।

śivadevasya ullekhaḥ vivaraṇapustikāyām asti

vad

pūrvadarśanaḥ   

ekaḥ puruṣaḥ ।

purāṇe pūrvadarśanasya varṇanaṃ vidyate

vad

pūrvadevikā   

pūrvabhārate sthitasya ekaḥ grāmaḥ ।

pāṇininā pūrvadevikā ullikhitā

vad

pramuditavadanā   

chandaviśeṣaḥ ।

abhijāta-saṃskṛtasāhitye pramuditavadanāyāḥ prayogaṃ dṛśyate

vad

priyaṃvadakaḥ   

ekaḥ puruṣaḥ ।

mudrārākṣasa-nāṭake priyaṃvadakaḥ samullikhitaḥ āsīt

vad

preṣyavadhūḥ   

ekā strī ।

bhaṭṭanārāyaṇakṛta veṇīsaṃhāra iti nāṭake buddhimatikā nāma ekā preṣyavadhūḥ nirdiṣṭā prāpyate

vad

preṣyavadhūḥ   

ekā strī ।

bhaṭṭanārāyaṇakṛta veṇīsaṃhāra iti nāṭake buddhimatikā nāma ekā preṣyavadhūḥ nirdiṣṭā prāpyate

vad

keśavadāsaḥ   

naikeṣāṃ lekhakānāṃ nāmaviśeṣaḥ ।

keśavadāsasya varṇanaṃ kośe samupalabhyate

vad

keśavadīkṣitaḥ   

ekaḥ puruṣaḥ ।

keśavadīkṣitasya varṇanaṃ kośe dṛśyate

vad

keśavadaivajñaḥ   

ekaḥ khagolaśāstrajñaḥ ।

keśavadaivajñasya ullekhaḥ kośe prāpyate

vad

sarvadarājaḥ   

ekaḥ rājā ।

sarvadarājasya ullekhaḥ bauddhasāhitye asti

vad

bhagavadānandaḥ   

ekaḥ lekhakaḥ ।

kośakāraiḥ bhagavadānandaḥ nirdiṣṭaḥ

vad

bhagavadudyamanāṭakam   

ekaṃ nāṭakam ।

abhijāta-saṃskṛta-vāṅmaye bhagavadudyamanāṭakaṃ suvikhyātam āsīt

vad

bhagavadgovindaḥ   

ekaḥ kaviḥ ।

kośeṣu bhagavadgovindasya nirdeśaḥ prāpyate

vad

bhagavaddāsaḥ   

ekaḥ ṭīkākāraḥ ।

jayadevasya gītagovindasya bhagavaddāsena kṛtā ṭīkā prasiddhā

vad

bhagavadbhaṭṭaḥ   

rasa-taraṅgiṇī iti racanāyāḥ ekaḥ ṭīkākāraḥ ।

bhagavadbhaṭṭaḥ kośeṣu ullikhitaḥ

vad

bhagavadbhāvakaḥ   

ekaḥ ṭīkākāraḥ ।

chāndogya-upaniṣadaḥ bhagavadbhāvakaḥ kṛtā ṭīkā prasiddhā

vad

bhagavadrātaḥ   

ekaḥ puruṣaḥ ।

bhāgavata-purāṇe bhagavadrātaḥ samullikhitaḥ

vad

bhagavadviśeṣaḥ   

ekaḥ puruṣaḥ ।

bauddhasāhitye bhagavadviśeṣaḥ varṇitaḥ dṛśyate

vad

bhavadattaḥ   

ekaḥ manuṣyaḥ ।

hemacandrasya pariśiṣṭaparvaṇi bhavadattaḥ samullikhitaḥ

vad

bhavadattaḥ   

ekaḥ ṭīkākāraḥ ।

bhavadattena naiṣadha-carite tathā ca śiśupāla-vadhe ṭīkā likhitā

vad

bhavadevaḥ   

vividhānāṃ lekhakānām ekaḥ nāmaviśeṣaḥ ।

kośeṣu bhavadevaḥ samullikhitaḥ

vad

bhavaddevaḥ   

ekaḥ puruṣaḥ ।

kośakāraiḥ bhavaddevaḥ nirdiṣṭaḥ

vad

sarvadāsaḥ   

ekaḥ kaviḥ ।

sarvadāsasya ullekhaḥ vivaraṇapustikāyām asti

vad

sarvadevasūriḥ   

ekaḥ lekhakaḥ ।

sarvadevasūreḥ ullekhaḥ vivaraṇapustikāyām asti

vad

sarvadharaḥ   

ekaḥ kośakāraḥ ।

sarvadharasya ullekhaḥ vivaraṇapustikāyām asti

vad

sarvadharmā   

ekaḥ rājā ।

sarvadharmaṇaḥ ullekhaḥ viṣṇupurāṇe asti

vad

salvadeśaḥ   

ekaḥ deśaḥ ।

salvadeśasya ullekhaḥ koṣe asti

vad

saṃśaptakavadhaparva   

mahābhāratasya ekaḥ bhāgaḥ ।

saṃśaptavadhaparvasya ullekhaḥ koṣe asti

vad

sārvadhātukaḥ   

daśasu lakāreṣu caturṇāṃ lakārāṇāṃ tathā keṣāñcit pratyayāṇāṃ ekaḥ vibhāgaḥ ।

sārvadhātukāḥ pāṇininā varṇyate

vad

sarvadharam   

ekā kṛtiḥ ।

sarvadharasya ullekhaḥ koṣe asti

vad

keśavadāsaḥ   

naikeṣāṃ lekhakānāṃ nāmaviśeṣaḥ ।

keśavadāsasya varṇanaṃ kośe samupalabhyate

vad

keśavadīkṣitaḥ   

ekaḥ puruṣaḥ ।

keśavadīkṣitasya varṇanaṃ kośe dṛśyate

vad

keśavadaivajñaḥ   

ekaḥ khagolaśāstrajñaḥ ।

keśavadaivajñasya ullekhaḥ kośe prāpyate

vad

gucchavadhrā, guṇḍālā, jalodbhūtā, jalāśayā   

kṣudrakṣupaviśeṣaḥ asyā guṇāḥ kaṭutvam tiktatvam uṣṇatvam śothavraṇanāśitvañca ।

gucchavadhrāyāḥ varṇanaṃ rājanirghaṇṭe vartate

vad

gudavadanā   

ekā devatā ।

gudavadanāyāḥ varṇanaṃ kālacakre dṛśyate

vad

gūḍhārthatattvadīpikā   

ekaḥ ṭīkāgranthaḥ ।

gūḍhārthatattvadīpikāyāḥ ullekhaḥ kośe vartate

vad

malavadeśaḥ   

ekaḥ deśaḥ ।

kośeṣu malavadeśasya varṇanam avartata

vad

uddhavadūtaḥ   

kāvyaviśeṣaḥ ।

uddhavadūtaḥ iti nāmakayoḥ dvayoḥ kāvyayoḥ ullekhaḥ koṣe asti

vad

pārśvadevaḥ   

ekaḥ lekhakaḥ ।

pārśvadevasya ullekhaḥ vivaraṇapustikāyām asti

vad

pañcapādikāṭīkātattvadīpanam   

ekaḥ ṭīkāgranthaḥ ।

pañcapādikāṭīkātattvadīpanasya ullekhaḥ koṣe asti

vad

pañṭapādikāṭīkātattvadīpanam   

ekaḥ ṭīkāgranthaḥ ।

pañcapādikāṭīkātattvadīpanasya ullekhaḥ koṣe asti

vad

jīvadattaḥ   

ekaḥ puruṣaḥ ।

jīvadattasya ullekhaḥ kathāsaritsāgare asti

vad

jīvadattakaḥ   

ekaḥ puruṣaḥ ।

jīvadattakasya ullekhaḥ kathāsaritsāgare asti

vad

jīvadayāprakaraṇam   

ekaḥ jainagranthaḥ ।

jīvadayāprakaraṇasya ullekhaḥ koṣe asti

vad

jīvadāmā   

ekaḥ rājaputraḥ ।

jīvadāmnaḥ ullekhaḥ koṣe asti

vad

jīvadevaḥ   

ekaḥ puruṣaḥ ।

jīvadevasya ullekhaḥ koṣe asti

vad

davadagdhakaḥ   

tṛṇaviśeṣaḥ ।

davadagdhakasya ullekhaḥ kośe vartate

vad

devadattaḥ   

ekā alīkā ।

devadattaḥ kathāsaritsāgare parigaṇitā

vad

devadattaśathaḥ   

ekaḥ adhyāpakaḥ ।

devadattaśathasya ullekhaḥ kośe vartate

vad

devadamanikā   

ekā strī ।

devadamanikāyāḥ ullekhaḥ pañcadaṇḍacchattra-prabandhe vartate

vad

devadamanī   

ekā strī ।

devadamanyaḥ ullekhaḥ pañcadaṇḍacchattra-prabandhe vartate

vad

devadarśaḥ   

ekaḥ ācāryaḥ ।

devadarśaḥ atharvavedasya ācāryaḥ āsīt

vad

devadarśī   

ekaḥ ācāryaḥ ।

devadarśī atharvavedasya ācāryaḥ āsīt

vad

devadāsaḥ   

ekaḥ vaṇigputraḥ ।

devadāsasya ullekhaḥ bauddhasāhitye vartate

vad

devadharaḥ   

ekaḥ puruṣaḥ ।

devadharasya ullekhaḥ gṛhyasūtre vartate

vad

devadharmā   

ekaḥ rājā ।

devadharmaṇaḥ ullekhaḥ viṣṇupurāṇe vartate

vad

drāṅgavadhaḥ   

ekaḥ puruṣaḥ ।

drāṅgavasya ullekhaḥ pravaragrantheṣu vartate

vad

kāṇvadevaḥ   

ekaḥ puruṣaḥ ।

kāṇvadevasya ullekhaḥ kośe vartate

vad

dhruvadevī   

ekā rājakanyā ।

dhruvadevyāḥ ullekhaḥ koṣe asti

vad

dhvajavadaḥ   

ekaḥ puruṣaḥ ।

dhvajavadasya ullekhaḥ tikādigaṇe asti

vad

navadevakulam   

ekaṃ nagaram ।

navadevakulasya ullekhaḥ koṣe asti

vad

devadattaḥ   

govindadattasya putraḥ ।

devadattasya ullekhaḥ kathāsaritsāgare asti

vad

devadattaḥ   

rājñaḥ jayadattasya putraḥ ।

devadattasya ullekhaḥ koṣe asti

vad

devadattaḥ   

haridattasya putraḥ ।

devadattasya ullekhaḥ koṣe asti

vad

devadattaḥ   

lekhakanāmaviśeṣaḥ ।

devadattaḥ iti nāmakānāṃ naikeṣāṃ lekhakānām ullekhaḥ vivaraṇapustikāyām asti

vad

devadattaḥ   

ekaḥ nāgaḥ ।

devadattasya ullekhaḥ bhāgavatapurāṇe asti

vad

devadamanikā   

ekā strī ।

devadamanikāyāḥ ullekhaḥ pañcadaṇḍacchatraprabandhe asti

vad

devadamanī   

ekā strī ।

devadamanyāḥ ullekhaḥ pañcadaṇḍacchatraprabandhe asti

vad

devadarśaḥ   

athavarvedasya ācāryaḥ ।

devadarśasya ullekhaḥ koṣe asti

vad

devadarśī   

atharvavedasya śālā ।

devadarśinaḥ ullekhaḥ kauśika-sūtre asti

vad

devadāsaḥ   

ekaḥ vaṇijaḥ putraḥ ।

devadāsasya ullekhaḥ kathāsaritsāgare asti

vad

devadāsaḥ   

kālidāsasya putraḥ ।

devadāsasya ullekhaḥ koṣe asti

vad

devadāsaḥ   

lekhakanāmaviśeṣaḥ ।

devadāsaḥ iti nāmakānāṃ naikeṣāṃ lekhakāṇām ullekhaḥ vivaraṇapustikāyām asti

vad

devadharaḥ   

gṛhyasūtrasya ekaḥ paṇḍitaḥ ।

devadharasya ullekhaḥ koṣe asti

vad

devadharmā   

ekaḥ rājā ।

devadharmaṇaḥ ullekhaḥ viṣṇupurāṇe asti

vad

drāṅgavadhaḥ   

ekaḥ puruṣaḥ ।

drāṅgavadhasya ullekhaḥ pravaragrantheṣu asti

Parse Time: 2.988s Search Word: vad Input Encoding: IAST: vad