Donate
 
   
Select your prefered input and type any Sanskrit or English word. Enclose the word in “” for an EXACT match e.g. “yoga”.
     Grammar Search "asi" has 2 results.
     
asi: feminine vocative singular stem: asi
asi: second person singular present present class 2 parasmaipadaas
     Amarakosha Search  
27 results
     
WordReferenceGenderNumberSynonymsDefinition
arhitaḥ3.1.102MasculineSingularnamasyitam, namasim, apacāyitam, arcitam, apacitam
asi3.5.11MasculineSingular
asihetiḥ2.8.71MasculineSingularnaistriṃśikaḥ
asiknī2.6.18FeminineSingular
bandhanam3.4.14NeuterSingularprasitiḥ, cāraḥ
bhakṣitaḥMasculineSingularglastam, annam, khāditam, liptam, bhuktam, grastam, abhyavahṛtam, gilitam, carvitam, aśitam, jagdham, psātam, pratyasitam
bhūtiḥ1.1.59-60Ubhaya-lingaSingularbhasma, kṣāraḥ, rakṣā, bhasitamash
buddham3.1.110MasculineSingularmanitam, viditam, pratipannam, avasitam, avagatam, budhitam
churikā2.8.93FeminineSingularśastrī, asiputrī, asidhenukā
daśā3.3.224FeminineSingularatiprasiddhaḥ
dhānyam2.9.24MasculineSingularṛddham, ‍āvasitam
gṛham2.2.4-5NeuterSingularagāram, vastyam, sadma, geham, ālayaḥ, gṛhāḥ, bhavanam, niśāntam, veśma, nilayaḥ, mandiram, sadanam, niketanam, udavasitam, nikāyyaḥ
khaḍgaḥ2.8.90MasculineSingularkṛpāṇaḥ, asi, riṣṭiḥ, kaukṣethakaḥ, maṇḍalāgraḥ, nistriṃśaḥ, karavālaḥ, candrahāsaḥ
kṛṣṇaḥMasculineSingularśyāmaḥ, kālaḥ, śyāmalaḥ, mecakaḥ, nīlaḥ, asitaḥblack or dark blue
kuśam3.3.224NeuterSingularsāhasikaḥ, kaṭhoraḥ, avasṛṇaḥ
madaḥ3.3.98MasculineSingularsthānam, lakṣma, aṅghri, vastu, vyavasitiḥ, trāṇam
madanaḥ1.1.25-26MasculineSingularbrahmasūḥ, māraḥ, kandarpaḥ, kāmaḥ, sambarāriḥ, ananyajaḥ, makaradhvajaḥ, viśvaketuḥ, pradyumnaḥ, darpakaḥ, pañcaśaraḥ, manasijaḥ, puṣpadhanvā, ātmabhūḥ, manmathaḥ, mīnaketanaḥ, anaṅgaḥ, smaraḥ, kusumeṣuḥ, ratipatiḥkamadeva
praphullaḥMasculineSingularvikacaḥ, sphuṭaḥ, phullaḥ, utphullaḥ, vikasitaḥ, saṃphullaḥ, vyākośaḥ
śākyamuniḥ1.1.14-15MasculineSingularsarvārthasiddhaḥ, śauddhodaniḥ, gautamaḥ, arkabandhuḥ, māyādevīsutaḥ, śākyasiṃhaḥbuddha
śastramārjikaḥ2.10.7MasculineSingularasidhāvakaḥ
stanitam1.3.8NeuterSingularmeghanirghoṣaḥ, rasitam, garjitamthe rattling of thunder
tāntrikaḥ2.8.13MasculineSingular‍jñātasiddhāntaḥ
tatparaḥ3.1.7MasculineSingularprasitaḥ, āsaktaḥ
vihasitamNeuterSingulara laugh
rasilaḥ2.8.77MasculineSingularurasvān
avasitaḥ3.1.98MasculineSingularsitaḥ
prasiddhaḥ3.3.111MasculineSingularśailaḥ, pāṣāṇaḥ
     Monier-Williams
          Search  
1234 results for asi
     
Devanagari
BrahmiEXPERIMENTAL
asim. (2. as-), a sword, scimitar, knife (used for killing animals) etc. View this entry on the original dictionary page scan.
asif. Name of a river (near Benares) (confer, compare asī-) ; [ Latin ensi-s.] View this entry on the original dictionary page scan.
asim. (also) a shark, alligator, View this entry on the original dictionary page scan.
asibaddhamfn. girt with a dagger or sword, View this entry on the original dictionary page scan.
asicaryāf. exercise or practice of arms View this entry on the original dictionary page scan.
asidaṃṣṭra m. "having swords for fangs", the marine monster makara- (painted on the banner of kāmadeva-) View this entry on the original dictionary page scan.
asidaṃṣṭrakam. "having swords for fangs", the marine monster makara- (painted on the banner of kāmadeva-) View this entry on the original dictionary page scan.
asiddhamfn. imperfect, incomplete : unaccomplished, uneffected View this entry on the original dictionary page scan.
asiddhamfn. unproved View this entry on the original dictionary page scan.
asiddhamfn. (regarded as) not existing or (as) not having taken effect (as a rule or operation taught in grammar) View this entry on the original dictionary page scan.
asiddhamfn. not possessed of magic power. View this entry on the original dictionary page scan.
asiddhāntam. not an incontestable dogma View this entry on the original dictionary page scan.
asiddhārthamfn. who has not effected his aim View this entry on the original dictionary page scan.
asiddhif. imperfect accomplishment, failure
asiddhif. (in logic) want of proof, conclusion not warranted by the premises View this entry on the original dictionary page scan.
asiddhif. (in sāṃkhya- philosophy) incompleteness (eight forms of it are enumerated) View this entry on the original dictionary page scan.
asiddhidamfn. not giving success View this entry on the original dictionary page scan.
asidharam. Name of a man View this entry on the original dictionary page scan.
asidhārāf. the blade of a sword etc. View this entry on the original dictionary page scan.
asidhārāpatham. equals asi-path/a- q.v , View this entry on the original dictionary page scan.
asidhārāvratan. an exceedingly difficult task View this entry on the original dictionary page scan.
asidhāva m. a sword- or tool-cleaner, armourer View this entry on the original dictionary page scan.
asidhāvakam. a sword- or tool-cleaner, armourer View this entry on the original dictionary page scan.
asidhenuf. a (small) knife View this entry on the original dictionary page scan.
asidhenukāf. idem or 'f. a (small) knife '
asigaṇḍam. equals kṣudropadhāna- (for kṣurop-?) View this entry on the original dictionary page scan.
asihatyan. fighting with swords (or knives), (gaRa anuśatikādi- q.v) View this entry on the original dictionary page scan.
asihetim. a swordsman or soldier armed with a sword View this entry on the original dictionary page scan.
asijalan. blood dripping from a sword, View this entry on the original dictionary page scan.
asijihvam. "sword-tongued", Name (also title or epithet) of an asura-, View this entry on the original dictionary page scan.
asikan. the part of the face between the underlip and the chin View this entry on the original dictionary page scan.
asikam. plural Name of a people (varia lectio aśika-). View this entry on the original dictionary page scan.
asiknīVed. f. of 2. /asita- q.v View this entry on the original dictionary page scan.
asiknīf. "the dark one", the night View this entry on the original dictionary page scan.
asiknīf. a girl attending in the women's apartments View this entry on the original dictionary page scan.
asiknīf. Name of a wife of dakṣa- View this entry on the original dictionary page scan.
asiknīf. Name of the river Akesines (afterwards called candra-bhāgā-) in the Panjab (asikn/ī-) View this entry on the original dictionary page scan.
asiknikāf. (equals asiknī- q.v) a girl attending in the women's apartments View this entry on the original dictionary page scan.
asilatāf. the blade of a sword View this entry on the original dictionary page scan.
asilomanm. Name of a dānava- View this entry on the original dictionary page scan.
asimārgam. plural the various ways of handling a sword, View this entry on the original dictionary page scan.
asimatmfn. furnished with knives or daggers View this entry on the original dictionary page scan.
asimedam. the fetid Mimosa (Vachellia Farnesiana) (see ahi-māra-,etc.) View this entry on the original dictionary page scan.
asinvamf(-)n. insatiable View this entry on the original dictionary page scan.
asinvatmfn. idem or 'mf(-)n. insatiable ' View this entry on the original dictionary page scan.
asipāṇimfn. having a sword in one's hand View this entry on the original dictionary page scan.
asipatham. the course of the sword or knife that kills View this entry on the original dictionary page scan.
asipattran. the blade of a sword View this entry on the original dictionary page scan.
asipattram. "having sword-shaped leaves", the sugar-cane (Scirpus Kysoor Roxb.) View this entry on the original dictionary page scan.
asipattram. "paved with swords", Name of a hell View this entry on the original dictionary page scan.
asipattrakam. the sugar-cane View this entry on the original dictionary page scan.
asipattravanan. Name of a hell etc. View this entry on the original dictionary page scan.
asipattravratan. equals asidhārā-vrata- q.v View this entry on the original dictionary page scan.
asipattravṛkṣam. a kind of tree in the lower world [Comm.] View this entry on the original dictionary page scan.
asiplavam. a kind of porpoise, View this entry on the original dictionary page scan.
asipucchakam. the Gangetic porpoise (Delphinus Gangeticus). View this entry on the original dictionary page scan.
asiputrīf. "daughter of a sword", a (small) knife View this entry on the original dictionary page scan.
asiputrikā f. "daughter of a sword", a (small) knife View this entry on the original dictionary page scan.
asiram. (2. as-),"an arrow", a beam, ray View this entry on the original dictionary page scan.
asiśimbīf. Name of a vegetable View this entry on the original dictionary page scan.
asiṣṭhamfn. (superl.) most skilful in shooting (arrows, etc.) View this entry on the original dictionary page scan.
asisūnāf. (= sūnā-), View this entry on the original dictionary page scan.
asitamfn. unbound View this entry on the original dictionary page scan.
asitamf(ā-;Ved. /asiknī-)n. (sita-,"white", appears to have been formed from this word, which is probably original, and not a compound of a-and sita-; see asura-and sura-), dark-coloured, black etc. View this entry on the original dictionary page scan.
asitam. the planet Saturn View this entry on the original dictionary page scan.
asitam. a poisonous animal (said to be a kind of mouse) View this entry on the original dictionary page scan.
asitam. Name of the lord of darkness and magic View this entry on the original dictionary page scan.
asitam. of a descendant of kaśyapa- (composer of ), named also devala- ([ ]) or asita- devala- ([ ]) View this entry on the original dictionary page scan.
asitam. Name of a man (with the patron. vārṣagaṇa-) View this entry on the original dictionary page scan.
asitam. of a son of bharata- View this entry on the original dictionary page scan.
asitam. of a ṛṣi- View this entry on the original dictionary page scan.
asitam. of a mountain View this entry on the original dictionary page scan.
asitam. a black snake View this entry on the original dictionary page scan.
asitam. a mantra- (saving from snakes) View this entry on the original dictionary page scan.
asif. a girl attending in the women's apartments (whose hair is not whitened by age) View this entry on the original dictionary page scan.
asitam. the indigo plant View this entry on the original dictionary page scan.
asitam. Name of an apsaras- View this entry on the original dictionary page scan.
asita2 m. (also) the dark half of a lunar month, View this entry on the original dictionary page scan.
asitaa particular intoxicating drink, View this entry on the original dictionary page scan.
asitābhraśekharam. Name of a buddha- View this entry on the original dictionary page scan.
asitabhrūmfn. having black eyelids. View this entry on the original dictionary page scan.
asitadrumam. the tree Xanthochymus Pictorius View this entry on the original dictionary page scan.
asitagatim. "having a black course", fire (- dyuti-,"shining like fire"), View this entry on the original dictionary page scan.
asitagrīvamfn. (/asita--) having a black neck () View this entry on the original dictionary page scan.
asitagrīvam. a peacock View this entry on the original dictionary page scan.
asitajānumfn. having black knees View this entry on the original dictionary page scan.
asitajñumf(Nominal verb -jñ/ūs-)n. idem or 'mfn. having black knees ' View this entry on the original dictionary page scan.
asitakeśāntamfn. having black locks View this entry on the original dictionary page scan.
asitākṣamf(ī-)n. equals asita-nayana- q.v View this entry on the original dictionary page scan.
asitālam. Name (also title or epithet) of a plant (from which the shafts of arrows are made), View this entry on the original dictionary page scan.
asitālum. Name of a plant View this entry on the original dictionary page scan.
asitāmburuham. the black lotus View this entry on the original dictionary page scan.
asitamṛgam. Name of a ṛṣi- of the View this entry on the original dictionary page scan.
asitamṛgam. plural his descendants View this entry on the original dictionary page scan.
asitamuṣkakam. the plant Schrebera Swietenioides View this entry on the original dictionary page scan.
asitānanam. a black-faced monkey, View this entry on the original dictionary page scan.
asitanayanamfn. black-eyed. View this entry on the original dictionary page scan.
asitāṅgam. a form of śiva- (especially mentioned in tantra-s) View this entry on the original dictionary page scan.
asitapucchakam. "having a black tail", Name of an animal (see kāla-pucchaka-.) View this entry on the original dictionary page scan.
asitaratnan. a sapphire, View this entry on the original dictionary page scan.
asitārcism. fire View this entry on the original dictionary page scan.
asitaskandham. a kind of amulet, View this entry on the original dictionary page scan.
asitāśmanm. the lapis lazuli View this entry on the original dictionary page scan.
asitavarṇa(/asita--) mfn. dark-coloured View this entry on the original dictionary page scan.
asitavartmanm. "having a black path (of smoke)", agni- View this entry on the original dictionary page scan.
asitekṣaṇamfn. blackeyed, View this entry on the original dictionary page scan.
asitodan. (id est saras-) Name of a mythical lake View this entry on the original dictionary page scan.
asitopalam. equals asitāśman- q.v View this entry on the original dictionary page scan.
asitotpalam. the blue lotus View this entry on the original dictionary page scan.
asiyaṣṭif. equals -latā- q.v View this entry on the original dictionary page scan.
asiyaṣṭif. (Prakritasi-laTThi) View this entry on the original dictionary page scan.
abhīṣṭasiddhif. the gaining a desired object.
abhyasitavyamfn. to be practised commentator or commentary on View this entry on the original dictionary page scan.
abhyupagamasiddhāntam. an admitted axiom View this entry on the original dictionary page scan.
abrahmavarcasinm. not an excellent theologian, View this entry on the original dictionary page scan.
adhikaraṇasiddhāntam. a syllogism or conclusion which involves others, etc. View this entry on the original dictionary page scan.
adhyavasitamfn. ascertained, determined, apprehended. View this entry on the original dictionary page scan.
adhyavasitif. exertion, effort. View this entry on the original dictionary page scan.
advaitabrahmasiddhif. Name (also title or epithet) of work View this entry on the original dictionary page scan.
ajayasiṃham. Name (also title or epithet) of a king, View this entry on the original dictionary page scan.
alasibhūto become tired View this entry on the original dictionary page scan.
amarasiṃham. "god-lion", Name of a renowned lexicographer (probably of the sixth century A.D.;he was a Buddhist, and is said to have adorned the court of vikramāditya-, being included among the nine gems). View this entry on the original dictionary page scan.
āmbhasikamfn. living in water, aquatic View this entry on the original dictionary page scan.
āmbhasikam. a fish commentator or commentary on View this entry on the original dictionary page scan.
amoghasiddhim. Name of the fifth dhyānibuddha-. View this entry on the original dictionary page scan.
anadhyavasitamfn. irresolute, View this entry on the original dictionary page scan.
anavasitamfn. not set, not terminated View this entry on the original dictionary page scan.
anavasif. Name of a species of the triṣṭubh- metre (consisting of four lines with eleven feet in each). View this entry on the original dictionary page scan.
āndhasikamfn. (fr. 2. andhas-), cooking View this entry on the original dictionary page scan.
āndhasikam. a cook View this entry on the original dictionary page scan.
aniyasitamfn. relaxed, View this entry on the original dictionary page scan.
anubhavasiddhamfn. established by experience or perception. View this entry on the original dictionary page scan.
anuktasiddhif. (in dramatic language) a veiled or indirect compliment, View this entry on the original dictionary page scan.
anurasitan. echo View this entry on the original dictionary page scan.
anuttamāmbhasikan. indifference to and abstinence from sensual enjoyment (as involving injury to external objects). View this entry on the original dictionary page scan.
anuvasitamfn. dressed up, wrapped. View this entry on the original dictionary page scan.
anvavasitamfn. seized by View this entry on the original dictionary page scan.
apahasitan. silly or causeless laughter View this entry on the original dictionary page scan.
apahasitan. (also) smiling in tears, View this entry on the original dictionary page scan.
apasiddhāntam. an assertion or statement opposed to orthodox teaching or to settled dogma View this entry on the original dictionary page scan.
apasidh(Imper. 2. sg. -s/edha-,or -s/edha-,3. sg. -sedhatu-,3. plural -sedhantu-; pr. p. -s/edhat-) to ward off, remove, drive away View this entry on the original dictionary page scan.
aprasiddhamfn. not settled, unestablished View this entry on the original dictionary page scan.
aprasiddhamfn. unknown, uncelebrated View this entry on the original dictionary page scan.
aprasiddhamfn. unusual, uncommon, of no real existence, not current, not generally known. View this entry on the original dictionary page scan.
aprasiddhapadan. an obsolete word. View this entry on the original dictionary page scan.
ārambhasiddhif. Name of work View this entry on the original dictionary page scan.
araṇyadvādasif. the twelfth day of the month mārgaśīrṣa- View this entry on the original dictionary page scan.
araṇyadvādasif. with or without -vrata- n. Name of a ceremony performed on this day View this entry on the original dictionary page scan.
arasikamfn. devoid of taste, unfeeling, dull. View this entry on the original dictionary page scan.
ārasitan. roaring, screaming View this entry on the original dictionary page scan.
arjunasiṃham. Name of a prince View this entry on the original dictionary page scan.
arśasinmfn. equals arśasa- View this entry on the original dictionary page scan.
arthasiddhamfn. clear in itself. self-evident View this entry on the original dictionary page scan.
arthasiddham. Name of the tenth day of the karma-māsa-, View this entry on the original dictionary page scan.
arthasiddham. Name of śākyamuni- in one of his previous births (as a bodhisattva-).
arthasiddhakam. the plant Vitex Negundo View this entry on the original dictionary page scan.
arthasiddhif. acquisition of wealth View this entry on the original dictionary page scan.
arthasiddhif. success View this entry on the original dictionary page scan.
arthasiddhif. Name of a particular magical faculty View this entry on the original dictionary page scan.
arthasiddhim. Name of a son of puṣya- View this entry on the original dictionary page scan.
āryasiddhāntam. Name of work of āryabhaṭa-. View this entry on the original dictionary page scan.
āryasiṃham. Name of a Buddhist patriarch. View this entry on the original dictionary page scan.
asāhasikamf(ī-)n. not acting boldly or inconsiderately View this entry on the original dictionary page scan.
aśāstrasiddhamfn. not enjoined or established by the śāstra-s. View this entry on the original dictionary page scan.
asyasiind. sword against sword View this entry on the original dictionary page scan.
atasi /atka-. See sub voce, i.e. the word in the Sanskrit order View this entry on the original dictionary page scan.
atasim. ( at-), a wandering mendicant View this entry on the original dictionary page scan.
atihasitan. excessive laughter. View this entry on the original dictionary page scan.
atihasitan. (in rhetoric) excessive or foolish laughter, View this entry on the original dictionary page scan.
atiprasiddhamfn. very notorious. View this entry on the original dictionary page scan.
atiśreyasim. a man superior to the most excellent woman. View this entry on the original dictionary page scan.
aṭṭahasitan. loud laughter, a horse-laugh. View this entry on the original dictionary page scan.
aujasikamfn. energetic, vigorous View this entry on the original dictionary page scan.
aupacchandasikamfn. (fr. upa-cchandas-), conformable to the veda-, Vedic View this entry on the original dictionary page scan.
aupacchandasikan. Name of a metre (consisting of four lines of alternately eleven and twelve syllabic instantsSee grammar 969).
aurasim. a descendant of uras- (?). View this entry on the original dictionary page scan.
aurasikamfn. like a breast gaRa aṅguly-ādi- View this entry on the original dictionary page scan.
aurdhvasrotasikam. (fr. ūrdhva-srotas-), a śaiva- (q.v) View this entry on the original dictionary page scan.
auṣasikamfn. walking out at daybreak View this entry on the original dictionary page scan.
auṣasikamfn. early, matutinal etc. View this entry on the original dictionary page scan.
avanāṭanasikamfn. flat-nosed View this entry on the original dictionary page scan.
avasic(parasmE-pada -siñcat-; ind.p. -sicya-) to sprinkle, pour upon (accusative or locative case) ; to pour out : Causal (Potential -secayet-) to sprinkle, bedew View this entry on the original dictionary page scan.
avasidh(imperfect tense avāsedhat- varia lectio apās-) to keep back or off from (ablative) View this entry on the original dictionary page scan.
avasiktamfn. sprinkled View this entry on the original dictionary page scan.
avasiñcitamfn. idem or 'mfn. sprinkled ' View this entry on the original dictionary page scan.
avasitamfn. one who has put up at any place, who dwells, rests, resides View this entry on the original dictionary page scan.
avasitamfn. brought to his abode (as agni-) View this entry on the original dictionary page scan.
avasitamfn. ended, terminated, finished, completed View this entry on the original dictionary page scan.
avasitamfn. one who has given up anything (ablative ;or in compound ) View this entry on the original dictionary page scan.
avasitamfn. determined, fixed View this entry on the original dictionary page scan.
avasitamfn. ascertained View this entry on the original dictionary page scan.
avasitamfn. known, understood View this entry on the original dictionary page scan.
avasitamfn. one who is determined to (locative case) View this entry on the original dictionary page scan.
avasitamfn. being at end of the line of a verse (See ava-s/āna-) View this entry on the original dictionary page scan.
avasitamfn. stored (as grain etc.) View this entry on the original dictionary page scan.
avasitamfn. gone View this entry on the original dictionary page scan.
avasitan. "a dwelling-place" See navāvasit/a-. View this entry on the original dictionary page scan.
āvasita equals avasita- (q.v) View this entry on the original dictionary page scan.
avasitakāryamfn. one who has finished what had to be done, satisfied, View this entry on the original dictionary page scan.
avasitamaṇḍanamfn. entirely adorned or dressed, View this entry on the original dictionary page scan.
avasitārthamfn. (= ta-- kārya-), View this entry on the original dictionary page scan.
avasitif. conclusion, end, View this entry on the original dictionary page scan.
avyavasitamfn. idem or 'mfn. inactive, negligent, remiss ' View this entry on the original dictionary page scan.
ayutasiddhamfn. (in philosophy) proved to be not separated (by the intervention of space), proved to be essentially united (as organic bodies, etc.) View this entry on the original dictionary page scan.
ayutasiddhif. establishing by proof that certain objects or ideas are essentially united and logically inseparable. View this entry on the original dictionary page scan.
bādhasiddhāntagranthakroḍam. Name of work View this entry on the original dictionary page scan.
bādhasiddhāntagranthānugamam. Name of work View this entry on the original dictionary page scan.
bādhasiddhāntagranthaprakāśam. Name of work View this entry on the original dictionary page scan.
bādhasiddhāntagranthaṭīkāf. Name of work View this entry on the original dictionary page scan.
bādhasiddhāntagranthavivecanan. Name of work View this entry on the original dictionary page scan.
bālamallavenasiddhāntam. Name of work View this entry on the original dictionary page scan.
bālasiṃham. Name of a man View this entry on the original dictionary page scan.
bāṇasiddhif. the hitting of a mark by an arrow View this entry on the original dictionary page scan.
bhāgavatasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
bhairavasiṃham. Name of a son of narasiṃha- and patron of ruci-pati- View this entry on the original dictionary page scan.
bhaktasiktha m. equals -pulāka- View this entry on the original dictionary page scan.
bhaktasikthakam. equals -pulāka- View this entry on the original dictionary page scan.
bhaktirasāmṛtasindhum. Name of work View this entry on the original dictionary page scan.
bhasitamfn. reduced to ashes View this entry on the original dictionary page scan.
bhasitan. ashes View this entry on the original dictionary page scan.
bhāvasiṃham. Name of a king (also -deva-; see -vilāsa-) View this entry on the original dictionary page scan.
bhāvasiṃhaprakriyāf. Name of an elementary grammar. View this entry on the original dictionary page scan.
bhavasindhu() m. equals -jala-. View this entry on the original dictionary page scan.
bhīmasiṃham. () Name of poets. View this entry on the original dictionary page scan.
bhīmasiṃhapaṇḍitam. () Name of poets. View this entry on the original dictionary page scan.
bhramaṇavilasitan. Name of a metre (see bhramara-v-). View this entry on the original dictionary page scan.
bhramaravilasitamfn. hovered round by bees View this entry on the original dictionary page scan.
bhramaravilasitan. the hovering or sporting of bees View this entry on the original dictionary page scan.
bhramaravilasitan. Name of a metre View this entry on the original dictionary page scan.
bhṛgvaṅgirasif. the matrimonial union between the descendants of bhṛgu- and those of aṅgiras- View this entry on the original dictionary page scan.
bhūpasiṃham. Name of a man View this entry on the original dictionary page scan.
bisanasif. a kind of crane (see -kaṇṭhikā-). View this entry on the original dictionary page scan.
bodhaikasiddhif. Name of work View this entry on the original dictionary page scan.
bodhasiddhif. Name of work View this entry on the original dictionary page scan.
borasiddhif. Name of a place View this entry on the original dictionary page scan.
brahmasiddhāntam. Name of various astronomy works. (also brahmasiddhāntapaddhati -paddhati- f.) View this entry on the original dictionary page scan.
brāhmasiddhāntam. Name of work View this entry on the original dictionary page scan.
brahmasiddhāntapaddhatif. brahmasiddhānta
brahmasiddhim. Name of a muni- View this entry on the original dictionary page scan.
brahmasiddhim. of a vedānta- work View this entry on the original dictionary page scan.
brahmasiddhivyākhyāratnan. Name of a commentator or commentary on it. View this entry on the original dictionary page scan.
brahmasphuṭasiddhāntam. Name of an astronomy work by brahma-gupta- (also called brahma-siddhānta-): View this entry on the original dictionary page scan.
brahmatulyasiddhāntam. Name of work View this entry on the original dictionary page scan.
brahmāvabodhavivekasindhum. brahmāvabodha
brahmavarcasinmfn. eminent in sacred knowledge, holy (Comparative degree s/i-tara-) View this entry on the original dictionary page scan.
brahmayaśasinmfn. renowned for sanctity View this entry on the original dictionary page scan.
bṛhadvasiṣṭham. the larger vasiṣṭha-. View this entry on the original dictionary page scan.
buddhasiṃham. Name of a man View this entry on the original dictionary page scan.
caitasikamfn. relating to the mind (cetas-,as duties) View this entry on the original dictionary page scan.
camasif. equals -, a kind of cake View this entry on the original dictionary page scan.
camasinmfn. entitled to receive a camasa- (filled with soma-) View this entry on the original dictionary page scan.
camasinm. Name of a man gaRa 1. naḍādi-. View this entry on the original dictionary page scan.
canasitamfn. (Passive voice parasmE-pada fr. sya-) "satisfied, gracious"(only the vocative case is used in the address to a Brahman, added after his N. ) () View this entry on the original dictionary page scan.
canasitavatmfn. (speech or address) containing the word canasita-, View this entry on the original dictionary page scan.
canasitottaramfn. followed by canasita- (a N.) View this entry on the original dictionary page scan.
caṇḍasiṃham. Name of a prince View this entry on the original dictionary page scan.
candrajasiṃham. Name of a man. View this entry on the original dictionary page scan.
candrasiṃham. Name of a king (son of darpa-nārāyaṇa-) View this entry on the original dictionary page scan.
candrasiṃham. of a hero of kālikā- View this entry on the original dictionary page scan.
cāritrasiṃhagaṇim. Name of an author. View this entry on the original dictionary page scan.
caturvyavasitayamakan. a kind of yamaka- (in which the four quarters of a stanza are homophonous), View this entry on the original dictionary page scan.
catuṣpādasiddhif. complete knowledge of the 4 parts of medical science
chandasif. equals ndo-grantha-. View this entry on the original dictionary page scan.
chattrasinhan. Name of a tīrtha- View this entry on the original dictionary page scan.
cīnasicayam. a China or silken cloth View this entry on the original dictionary page scan.
cittacetasikam. thought View this entry on the original dictionary page scan.
dāmasiṃham. Name of a prince. View this entry on the original dictionary page scan.
ḍambarasiṃham. (with para-- mara-) Name (also title or epithet) of a king, View this entry on the original dictionary page scan.
daṇḍālasif. equals ḍakālasaka- View this entry on the original dictionary page scan.
daśonasim. Name of View this entry on the original dictionary page scan.
daśonasim. a snake View this entry on the original dictionary page scan.
daurgasiṃhamf(ī-)n. belonging to or composed by durga-siṃha- View this entry on the original dictionary page scan.
dehasiddhisādhanan. Name of work View this entry on the original dictionary page scan.
devasiddhim. Name of a man View this entry on the original dictionary page scan.
devasiṃham. "god-lion", Name of śiva- View this entry on the original dictionary page scan.
devasiṃham. of an author View this entry on the original dictionary page scan.
devayaśasinmfn. of divine gods View this entry on the original dictionary page scan.
dharmasiṃham. "lion of virtue", Name of a man View this entry on the original dictionary page scan.
dharmasindhum. "ocean of law"Name of several works. View this entry on the original dictionary page scan.
dharmasindhusāram. "essence of the ocean of law", Name of work View this entry on the original dictionary page scan.
dharṇasimfn. idem or 'mfn. strong, powerful, able ' (a synonym of bala- ) View this entry on the original dictionary page scan.
dharṇasimfn. full of spirit (as soma-) View this entry on the original dictionary page scan.
dharṇasin. support View this entry on the original dictionary page scan.
dhṛtasiṃha varia lectio for ti-s-. View this entry on the original dictionary page scan.
dhruvasiddhim. "through whom cure is sure", Name of a physician View this entry on the original dictionary page scan.
dhvasiramfn. sprinkled, spattered, covered, (see dhūsara-). View this entry on the original dictionary page scan.
dīpasikhopaniṣadf. Name of an View this entry on the original dictionary page scan.
dravyasiddhif. acquirement of wealth View this entry on the original dictionary page scan.
dravyasiddhif. success by wealth View this entry on the original dictionary page scan.
dravyātmakāryasiddhif. effecting one's object by means of wealth View this entry on the original dictionary page scan.
droṇasiṃham. Name of a prince of the vallabhī- dynasty View this entry on the original dictionary page scan.
dugdhasindhum. idem or 'm. the sea of milk ' View this entry on the original dictionary page scan.
duravasitamfn. difficult to be ascertained, unfathomed View this entry on the original dictionary page scan.
durgasiṃha(for -s- ) m. Name of a grammarian and of an astronomer View this entry on the original dictionary page scan.
durgasiṃhīf. durga-siṃha-'s commentary on the kātantra-. View this entry on the original dictionary page scan.
durvilasitan. a wayward or rude or naughty trick, ill-mannered act View this entry on the original dictionary page scan.
durvyavasitan. an evil intention View this entry on the original dictionary page scan.
dvādaśasiddhāntam. Name of work on the vedānta-. View this entry on the original dictionary page scan.
dvaitanirṇayasiddhāntasaṃgraham. dvaitanirṇaya
dvaitasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
dvaitasiddhif. Name of work View this entry on the original dictionary page scan.
gadasiṃham. Name of an author View this entry on the original dictionary page scan.
gaganasiṃham. Name (also title or epithet) of a kacchapa-ghāta- king, View this entry on the original dictionary page scan.
gaganasindhuf. the heavenly gaṅgā- View this entry on the original dictionary page scan.
gajasiṃham. Name of an author of Prakrit verses View this entry on the original dictionary page scan.
gajasiṃham. of a prince View this entry on the original dictionary page scan.
gajasiṃhacaritran. Name of work View this entry on the original dictionary page scan.
gajaturaṃgavilasitan. Name of a metre (see ṛṣabha-gaja-v-.) View this entry on the original dictionary page scan.
gajavilasif. Name of a metre View this entry on the original dictionary page scan.
gayasiṃham. for gaja-s- (Name of a prince) View this entry on the original dictionary page scan.
gayasiṃharājacaritran. equals gajasiṃha-c-. View this entry on the original dictionary page scan.
ghanasikthaa kind of gruel View this entry on the original dictionary page scan.
ghasim. food kāṇva-) ii, 24'> (see ghās/i-.) View this entry on the original dictionary page scan.
govindasiṃham. Name of a prince View this entry on the original dictionary page scan.
govindasiṃham. Name of one of the ten chief guru-s of the Sikhs View this entry on the original dictionary page scan.
grāmasiṃham. "village-lion" equals mṛga- View this entry on the original dictionary page scan.
grasiṣṇumfn. accustomed to swallow or absorb View this entry on the original dictionary page scan.
grasiṣṭhamfn. (superl.) swallowing most View this entry on the original dictionary page scan.
gūḍhasiramfn. having the arteries hidden, View this entry on the original dictionary page scan.
gūḍhasiratāf. one of a buddha-'s marks, . View this entry on the original dictionary page scan.
haradattasiṃham. Name of a modern author View this entry on the original dictionary page scan.
harasiddhipradāf. Name of a particular family-deity View this entry on the original dictionary page scan.
harasiṃham. Name of a king View this entry on the original dictionary page scan.
haribhaktirasāmṛtasindhum. Name of work View this entry on the original dictionary page scan.
hariharabrahmamānasikasnānavidhim. Name of work View this entry on the original dictionary page scan.
harikṛṣṇasiddhāntam. Name of an author View this entry on the original dictionary page scan.
hasif. laughter, derision, jesting View this entry on the original dictionary page scan.
hasiram. a kind of mouse (see haṃsira-) View this entry on the original dictionary page scan.
hasitamfn. laughing, jesting, smiling View this entry on the original dictionary page scan.
hasitamfn. one who has laughed (m."he laughed"equals jahāsa-) View this entry on the original dictionary page scan.
hasitamfn. mocked, ridiculed, surpassed, excelled, View this entry on the original dictionary page scan.
hasitamfn. blown, expanded View this entry on the original dictionary page scan.
hasitan. laughing, laughter (also impersonal or used impersonally = "it has been laughed") etc. View this entry on the original dictionary page scan.
hasitan. the bow of kāma- (god of love) View this entry on the original dictionary page scan.
hasitṛmfn. one who laughs, a laugher, smiler View this entry on the original dictionary page scan.
hastasiddhif. earnings gained by manual labour, salary View this entry on the original dictionary page scan.
hastiyaśasihastivarcasinmfn. (?)having an elephant's magnificence and splendour View this entry on the original dictionary page scan.
hāyanasindhum. Name of work View this entry on the original dictionary page scan.
hemantasiṃham. Name of a king of karṇapūra- View this entry on the original dictionary page scan.
hemasiṃham. a throne of golden View this entry on the original dictionary page scan.
himasikharinm. "snow-mountain", the himālaya- View this entry on the original dictionary page scan.
holasiṃham. Name of a man View this entry on the original dictionary page scan.
horilasiṃham. Name of a man (perhaps equals prec.) View this entry on the original dictionary page scan.
hoturantevasinm. the pupil of a hotṛ- priest View this entry on the original dictionary page scan.
hrasimanm. shortness, smallness gaRa pṛthvādi-. View this entry on the original dictionary page scan.
hrasiṣṭhamfn. (superl. fr: hrasva-) shortest or smallest, very short or small View this entry on the original dictionary page scan.
hrasitamfn. shortened, curtailed, diminished View this entry on the original dictionary page scan.
hrasitamfn. sounded View this entry on the original dictionary page scan.
indrasiṃham. Name of a poetry or poetic View this entry on the original dictionary page scan.
iyasitamfn. shrunk View this entry on the original dictionary page scan.
iyasitan. shrinking View this entry on the original dictionary page scan.
jagatprasiddhamfn. known throughout the world View this entry on the original dictionary page scan.
jalamasim. "water-ink", a dark cloud View this entry on the original dictionary page scan.
jalasiktamfn. water-sprinkled View this entry on the original dictionary page scan.
janakasiṃham. Name of a man View this entry on the original dictionary page scan.
jayasiṃham. Name of a Kashmir king View this entry on the original dictionary page scan.
jayasiṃham. of a man, View this entry on the original dictionary page scan.
jayasiṃham. of a son of rāma-siṃha- (1600 A.D.) View this entry on the original dictionary page scan.
jayasiṃham. of several other men View this entry on the original dictionary page scan.
jayasiṃhadevam. king jaya-siṃha- View this entry on the original dictionary page scan.
jinasiṃham. Name of the founder of the 3rd subdivision of the kharatara-gaccha- of the Jain community View this entry on the original dictionary page scan.
jinasiṃham. of a Jain sūri- (A. D. 1 559-1618). View this entry on the original dictionary page scan.
jīvasiddhim. Name of a man View this entry on the original dictionary page scan.
jñānasiddhim. Name of a man View this entry on the original dictionary page scan.
jñātasiddhāntamfn. completely versed in any science View this entry on the original dictionary page scan.
kālanirṇayasiddhāntam. Name of work View this entry on the original dictionary page scan.
kalasi varia lectio for kalaśi- above. View this entry on the original dictionary page scan.
kālasiṃham. Name of a Prakrit poetry or poetic View this entry on the original dictionary page scan.
kalpasiddhāntam. Name of a jaina- work. View this entry on the original dictionary page scan.
kāmarasikamfn. libidinous View this entry on the original dictionary page scan.
kandarpasiddhāntam. Name of a commentator. View this entry on the original dictionary page scan.
karmasiddhif. accomplishment of an act, success View this entry on the original dictionary page scan.
kārttikasiddhāntam. Name of a scholiast on the mugdha-bodha-. View this entry on the original dictionary page scan.
kārukasiddhāntinm. plural Name of a śaiva- sect commentator or commentary on View this entry on the original dictionary page scan.
kāryārthasiddhif. the accomplishment of any object or purpose View this entry on the original dictionary page scan.
kāryasiddhif. accomplishment of a work, fulfilment of an object, success View this entry on the original dictionary page scan.
kasipum. food (equals kaśipu-) View this entry on the original dictionary page scan.
kavitārkikasiṃham. "lion of poets and philosophers", Name of veṅkaṭa-nātha-. View this entry on the original dictionary page scan.
kāvyarasikamfn. having a taste for poetical compositions, View this entry on the original dictionary page scan.
keralasiddhāntam. Name of work View this entry on the original dictionary page scan.
khasindhum. (see -camasa-) Name of the moon View this entry on the original dictionary page scan.
khasindhuSee 3. kh/a-, p.334. View this entry on the original dictionary page scan.
khemasiṃha see kṣetra-- s-, kṣema-- s- (above). View this entry on the original dictionary page scan.
khetasiṃhasee kṣetra-- s-, kṣema-- s- (above). View this entry on the original dictionary page scan.
kṛṣṇapuruṣottamasiddhāntopaniṣadf. Name of an View this entry on the original dictionary page scan.
kṛṣṇasiṃham. Name of the author of the work trepanakriyākathā- View this entry on the original dictionary page scan.
kṣārasindhum. idem or 'm. the salt ocean ' View this entry on the original dictionary page scan.
kṣemasiṃha(or khema-- s-), m. Name (also title or epithet) of a king, View this entry on the original dictionary page scan.
kṣetrasiṃha(or kheta-- s-), m. Name (also title or epithet) of various kings, View this entry on the original dictionary page scan.
kṣīrasindhum. equals -dhi- View this entry on the original dictionary page scan.
kumārasiṃham. Name of an astronomer. View this entry on the original dictionary page scan.
kumbhīnasim. Name of a demon View this entry on the original dictionary page scan.
kuṇḍamaṇḍapasiddhif. Name of work by viṭṭhala-dīkṣita-. View this entry on the original dictionary page scan.
kuṇḍasiddhif. Name of work View this entry on the original dictionary page scan.
labdhasiddhimfn. one who has attained perfection View this entry on the original dictionary page scan.
laghuvaiyākaraṇabhūṣaṇasiddhāntamañjūṣāf. Name of work View this entry on the original dictionary page scan.
laghuvasiṣṭhasiddhāntam. Name of work View this entry on the original dictionary page scan.
laghuvāsiṣṭhasiddhāntam. Name of work View this entry on the original dictionary page scan.
laghvāryabhaṭasiddhāntam. Name of an astronomy work (equals mahā-siddhānta-). View this entry on the original dictionary page scan.
lakṣmaṇasiṃham. Name of an author View this entry on the original dictionary page scan.
lakṣmīnarasiṃham. Name of a king View this entry on the original dictionary page scan.
lakṣmīnarasiṃham. of various authors View this entry on the original dictionary page scan.
lakṣmīśvarasiṃha(ś-) m. Name of a king View this entry on the original dictionary page scan.
lakṣyasiddhif. the attainment of an object View this entry on the original dictionary page scan.
lālasiṃham. Name of an astronomer (see lalla-). View this entry on the original dictionary page scan.
lasif. spittle, saliva View this entry on the original dictionary page scan.
lasitamfn. played, sported etc. View this entry on the original dictionary page scan.
lavaṇasindhum. the salt-sea, sea, ocean commentator or commentary View this entry on the original dictionary page scan.
lohasiṃhānikā(?) f. rust of iron
lokācāryasiddhāntam. Name of work View this entry on the original dictionary page scan.
lokaprasiddhamfn. celebrated in the world, generally established, universally known View this entry on the original dictionary page scan.
lokaprasiddhif. universal establishment or reception (of any custom etc.), general prevalence ( lokaprasiddhyā dhyā- ind.according to prevalent usage) View this entry on the original dictionary page scan.
lokaprasiddhyāind. lokaprasiddhi
lokasiddhamfn. world-established, current among the people, usual, common
lokasiddhamfn. universally admitted, generally received View this entry on the original dictionary page scan.
madanasiṃham. Name of various authors View this entry on the original dictionary page scan.
mādhavasiṃham. Name of a king and poet View this entry on the original dictionary page scan.
madhvasiddhāntam. Name of work (and madhvasiddhāntabhañjana ta-bhañjana- n. madhvasiddhāntasāra ta-sāra-,m.) View this entry on the original dictionary page scan.
madhvasiddhāntabhañjanan. madhvasiddhānta
mādhvasiddhāntasāram. Name of work View this entry on the original dictionary page scan.
madhvasiddhāntasāram. madhvasiddhānta
madhyasiddhāntakaumudīf. "the middle-sized "Name of an abridgment of the by varada-rāja-. = View this entry on the original dictionary page scan.
mahāmānasif. (with jaina-s) Name of one of the 16 vidyā-devī-s View this entry on the original dictionary page scan.
mahāpaiṭhīnasim. Name of a preceptor View this entry on the original dictionary page scan.
mahārudrasiṃham. Name of an author View this entry on the original dictionary page scan.
mahāryasiddhāntam. Name of work View this entry on the original dictionary page scan.
mahāsāhasikamfn. extremely daring or foolhardy, one who goes to work very rashly View this entry on the original dictionary page scan.
mahāsāhasikam. a robber View this entry on the original dictionary page scan.
mahāsāhasikam. an assaulter, violator View this entry on the original dictionary page scan.
mahāsāhasikatāf. great boldness or daring View this entry on the original dictionary page scan.
mahāsāhasikatāf. great energy View this entry on the original dictionary page scan.
mahāsāhasikatayāind. in a very decided manner View this entry on the original dictionary page scan.
mahāsāhasinmfn. equals -rāhasika- mfn. (q.v) View this entry on the original dictionary page scan.
mahāvākyasiddhāntam. Name of work View this entry on the original dictionary page scan.
mahendrasiṃham. Name of a king View this entry on the original dictionary page scan.
maheśvarasiddhāntam. equals paśu-pati-śāstra- q.v View this entry on the original dictionary page scan.
maheśvarasiṃham. Name of a king of mithilā- (patron of ratna-pāṇi-) View this entry on the original dictionary page scan.
mahimasiṃhagaṇim. Name of two authors View this entry on the original dictionary page scan.
mālasif. (in music) a particular rāgiṇī- View this entry on the original dictionary page scan.
malayasiṃham. Name of two princes View this entry on the original dictionary page scan.
manasi locative case of manas-, in compound View this entry on the original dictionary page scan.
manasijam. "heart-born", love or the god of love View this entry on the original dictionary page scan.
manasijam. the moon View this entry on the original dictionary page scan.
manasijabṛsīf. the moon View this entry on the original dictionary page scan.
manasijatarum. love conceived as a tree View this entry on the original dictionary page scan.
mānasikamfn. (fr. manas-or mānasa-) committed (only) in thought (as a sin) View this entry on the original dictionary page scan.
mānasikamfn. conceived (only) in the mind, imaginary View this entry on the original dictionary page scan.
mānasikam. Name of viṣṇu- View this entry on the original dictionary page scan.
manasikāram. taking to heart View this entry on the original dictionary page scan.
manasimandamfn. slow or inert in love View this entry on the original dictionary page scan.
manasimandarujf. pain of love View this entry on the original dictionary page scan.
mānasiṃham. Name of a king and various authors View this entry on the original dictionary page scan.
mānasiṃhakīrtimuktāvalif. Name of work View this entry on the original dictionary page scan.
manasinmfn. having a mind or soul, having intellect View this entry on the original dictionary page scan.
manasiśayam. "lying in the heart" equals -ja- View this entry on the original dictionary page scan.
manoharasiṃham. Name of a king View this entry on the original dictionary page scan.
manorathasiddham. wrong reading for -siddhi- View this entry on the original dictionary page scan.
manorathasiddhif. the fulfilment of a wishes View this entry on the original dictionary page scan.
manorathasiddhim. (also dhika-) Name of a man View this entry on the original dictionary page scan.
mantrasiddhamfn. accomplished by a spell View this entry on the original dictionary page scan.
mantrasiddhamfn. thoroughly versed in spells View this entry on the original dictionary page scan.
mantrasiddhif. the effect of a spell View this entry on the original dictionary page scan.
mantrasiddhif. the carrying out a resolution or advice View this entry on the original dictionary page scan.
manuṣyayaśasinmfn. possessing human glory View this entry on the original dictionary page scan.
mārasiṃham. Name of a prince View this entry on the original dictionary page scan.
masiand masī-, incorrectly for maṣi- and maṣī- q.v (masī-bhū-,to become black ; see maṣī-bhāvuka-) View this entry on the original dictionary page scan.
masikam. a serpent's hole View this entry on the original dictionary page scan.
masif. Nyctanthes Arbor Tristis (see prec.; varia lectio malikā-). View this entry on the original dictionary page scan.
masinamfn. well ground, finely pounded View this entry on the original dictionary page scan.
masinamfn. kinship through the right of presenting the piṇḍa- to a common progenitor (equals sa-piṇḍaka-) View this entry on the original dictionary page scan.
māyārasikamfn. See -vasika-. View this entry on the original dictionary page scan.
māyāvasikamfn. equals para-pratāraka- (prob. w.r for -rasika-"fond of illusion or deceit") . View this entry on the original dictionary page scan.
mitākṣarasiddhāntasaṃgraham. Name of work connected with the mitākṣarā- View this entry on the original dictionary page scan.
mithyādhyavasiti(mithyādh-) f. a particular figure of speech (in which the impossibility of a thing is expressed by making it depend upon some impossible contingency) View this entry on the original dictionary page scan.
mokṣalakṣmīsāmrājyasiddhif. Name of work View this entry on the original dictionary page scan.
mokṣasāmrājyasiddhif. Name of work View this entry on the original dictionary page scan.
mokṣasiddhif. Name of work View this entry on the original dictionary page scan.
mṛgasiṃhakam. a species of small lion View this entry on the original dictionary page scan.
muhūrtasiddhif. Name of work View this entry on the original dictionary page scan.
muhūrtasindhum. Name of work View this entry on the original dictionary page scan.
mūlapuliśasiddhāntam. the original siddhānta- of puliśa- commentator or commentary View this entry on the original dictionary page scan.
murasidābāda= $ Murshidabad, Name of a city View this entry on the original dictionary page scan.
mūrdhāvasiktam. Name of a particular mixed caste (the son of a Brahman and a kṣatriyā-) (varia lectio mūrdhābhi ṣikta-)
mūrdhāvasiktam. a consecrated king View this entry on the original dictionary page scan.
mūrdhāvasiktam. an officer in the army (or"expert in the dhanur-veda-", or"one who carries arms, or know, the power of precious stones, mantra-s, and medicinal herbs") View this entry on the original dictionary page scan.
naiṣkarmyasiddhif. Name of work , a refutation of the mīmāṃsā- system. View this entry on the original dictionary page scan.
nāmasiddhāntam. View this entry on the original dictionary page scan.
namasitamfn. (prob. wrong reading for syita-See next) reverenced, worshipped View this entry on the original dictionary page scan.
nānāmantraughasiddhimatmfn. having plenty of various magic. formulas View this entry on the original dictionary page scan.
narasiṃham. "man-lion", great warrior View this entry on the original dictionary page scan.
narasiṃham. Name of viṣṇu- in his 4th ava-tāra- (when he was half man half lion) View this entry on the original dictionary page scan.
narasiṃham. Name of the father of king bhairava- View this entry on the original dictionary page scan.
narasiṃham. of several princes and authors (also -kavi-, -kavi-rāja-, -ṭhakkura-, -dīkṣita-, -deva-, -paṇḍita-, -bhaṭṭa-, -miśra-, -muni-, -yati-, -yatīndra-, -rāja-, -vājapeyin-(or gnicid-vāj-), -śāstrin-, -sarasvatī-, -sūri-, -sena-, n/arasiṃhācārya-) View this entry on the original dictionary page scan.
nārasiṃhamf(ī-)n. (fr. nara-siṃha-) relating or belonging to the man-lion (viṣṇu- in his 4th avatāra-) etc. View this entry on the original dictionary page scan.
nārasiṃham. the 16th kalpa- or period of the world (see sub voce, i.e. the word in the Sanskrit order) View this entry on the original dictionary page scan.
nārasiṃham. equals narasiṃha-, viṣṇu- as man-lion View this entry on the original dictionary page scan.
nārasiṃham. Name of a man View this entry on the original dictionary page scan.
nārasiṃhan. Name of a town View this entry on the original dictionary page scan.
narasiṃhabhāratīvilāsam. Name of work View this entry on the original dictionary page scan.
narasiṃhabhaṭṭīyan. Name of work View this entry on the original dictionary page scan.
narasiṃhabhujaṃgam. Name of work View this entry on the original dictionary page scan.
narasiṃhabhūpālacaritran. Name of work View this entry on the original dictionary page scan.
narasiṃhacūrṇan. Name of a particular aphrodisiac View this entry on the original dictionary page scan.
nārasiṃhacūrṇan. a particular aphrodisiac (see nara-siṃha-c-). View this entry on the original dictionary page scan.
narasiṃhadvādaśīf. Name of the 12th day in the light half of the month phālguna- ( narasiṃhadvādaśīvrata śī-vrata- n.a ceremony then performed, Name of work) View this entry on the original dictionary page scan.
narasiṃhadvādaśīvratan. narasiṃhadvādaśī
narasiṃhakalpam. Name of work View this entry on the original dictionary page scan.
narasiṃhanakhastotran. Name of stotra- View this entry on the original dictionary page scan.
narasiṃhapañcaratnan. Name of stotra- View this entry on the original dictionary page scan.
narasiṃhapārijātam. Name of work View this entry on the original dictionary page scan.
narasiṃhapurāṇan. Name of work View this entry on the original dictionary page scan.
nārasiṃhapurāṇan. Name of a View this entry on the original dictionary page scan.
narasiṃharājīyan. Name of work View this entry on the original dictionary page scan.
narasiṃharṣabhakṣetramāhātmyan. Name of work View this entry on the original dictionary page scan.
narasiṃhasahasranāmann. plural Name of work View this entry on the original dictionary page scan.
narasiṃhaśāstriprakāśikāf. Name of work View this entry on the original dictionary page scan.
nārasiṃhaṣaṭcakryupaniṣadf. Name of an View this entry on the original dictionary page scan.
narasiṃhastutif. Name of work View this entry on the original dictionary page scan.
nārasiṃhatantran. Name of a tantra-. View this entry on the original dictionary page scan.
narasiṃhavarmanm. Name of a man View this entry on the original dictionary page scan.
narasiṃhayantran. Name of a mystic. diagram View this entry on the original dictionary page scan.
nārasiṃhīyan. Name of work on rhetoric View this entry on the original dictionary page scan.
nārasiṃhopaniṣadf. View this entry on the original dictionary page scan.
nārasiṃhopapurāṇan. Name of an and an upapurāṇa- View this entry on the original dictionary page scan.
nasi idem or 'f. idem or 'm. (in fine compositi or 'at the end of a compound') the nose (see apī-n-, urū--, kumbhīn-etc.)' ' (?) View this entry on the original dictionary page scan.
nasiSee kumbhī-n-. View this entry on the original dictionary page scan.
nāthasiṃham. Name of an author View this entry on the original dictionary page scan.
nātiprasiddhamfn. not too well known View this entry on the original dictionary page scan.
navajvarebhasiṃham. Name of particular medicaments View this entry on the original dictionary page scan.
navāvasitan. (prob.) idem or 'n. a new dwelling ' View this entry on the original dictionary page scan.
nayasiddhif. political success View this entry on the original dictionary page scan.
nidāghasindhum. a river in hot weather, one nearly dry View this entry on the original dictionary page scan.
niḥśvasvasitamfn. breathed or breathing out, sighing View this entry on the original dictionary page scan.
niḥśvasvasitan. expiration View this entry on the original dictionary page scan.
niḥśvasvasitan. a sigh View this entry on the original dictionary page scan.
nīlasindhukam. Vitex Negundo View this entry on the original dictionary page scan.
niravavasitamfn. expelled, rejected View this entry on the original dictionary page scan.
nirhrasitamfn. shortened View this entry on the original dictionary page scan.
nirṇayasiddhāntam. Name of work View this entry on the original dictionary page scan.
nirṇayasindhum. Name of work View this entry on the original dictionary page scan.
nirvārāṇasimfn. one who has left vārāṇasī- Va1rtt. 3 View this entry on the original dictionary page scan.
nisargasiddhamfn. effected by nature, natural View this entry on the original dictionary page scan.
niśvasita(n/i--) n. breath, expiration or inspiration View this entry on the original dictionary page scan.
nityasiddhamfn. "ever perfect", a jaina- predicate of the soul View this entry on the original dictionary page scan.
nivasitamfn. clothed in (instrumental case) View this entry on the original dictionary page scan.
nivasitamfn. dwelled, lived (n. impersonal or used impersonally) View this entry on the original dictionary page scan.
nyāyasiddhāñjanan. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntam. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntacandrikāf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntadīpam. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamālāf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamañjarīf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamañjarībhūṣāf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamañjarīdipikāf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamañjarīprakāśam. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamañjarīsāram. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntamuktāvalīf. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntapañcānanam. Name of a viśva-nātha- View this entry on the original dictionary page scan.
nyāyasiddhāntatattvan. Name of work View this entry on the original dictionary page scan.
nyāyasiddhāntavāgīśam. Name of a gadā-dhara- View this entry on the original dictionary page scan.
nyāyasiddhāntvāmṛtan. Name of work View this entry on the original dictionary page scan.
pādalepasiddhif. its effect View this entry on the original dictionary page scan.
padāmnāyasiddhif. Name of work View this entry on the original dictionary page scan.
paitāmahasiddhāntam. Name of work View this entry on the original dictionary page scan.
paiṭhīnasim. patronymic of an ancient teacher (a muni- and author of a system of laws) View this entry on the original dictionary page scan.
paiṭhīnasismṛtif. Name of work View this entry on the original dictionary page scan.
panasif. a kind of disease, pustules on the ears and neck (see pinasa-, pīnasa-).
pānasindhu -saindhava- View this entry on the original dictionary page scan.
pañcasiddhāntam. Name of the bhāsvatī-karaṇa- (q.v) View this entry on the original dictionary page scan.
pañcasiddhāntikāf. Name of an astronomy work by varāha-mihira- (founded on the 5 older astronomy works., and called by himself karaṇa-). View this entry on the original dictionary page scan.
pañcasiddhauṣadhīf. the 5 medicine plants View this entry on the original dictionary page scan.
pañcasiddhauṣadhikamfn. consisting of 5 kinds of medicine plants View this entry on the original dictionary page scan.
paṇyasiddhif. prosperity in trade, View this entry on the original dictionary page scan.
pāpānuvasitamfn. addicted to sin, sinful View this entry on the original dictionary page scan.
parāmarśasiddhāntagranthakroḍam. Name of work
parāmarśasiddhāntagranthālokam. Name of work
parāmarśasiddhāntagranthaprakāśam. Name of work
parāmarśasiddhāntagranthaṭīkāf. Name of work
parāmarśasiddhāntagranthavivecanan. Name of work
parāmarśasiddhāntarahasyan. Name of work
parāśarasiddhāntam. Name of work View this entry on the original dictionary page scan.
pārasikamf(ī-)n. idem or 'f. See below.' (varia lectio sīka-) View this entry on the original dictionary page scan.
pārasikam. plural the Persian View this entry on the original dictionary page scan.
parihasitamfn. laughed at, ridiculed View this entry on the original dictionary page scan.
pariśiṣṭasiddhāntaratnākaram. Name of work View this entry on the original dictionary page scan.
parṇasim. (only ) a house upon or by the water View this entry on the original dictionary page scan.
parṇasim. a lotus View this entry on the original dictionary page scan.
parṇasim. a vegetable View this entry on the original dictionary page scan.
parṇasim. adorning, decoration. View this entry on the original dictionary page scan.
paryavasitamfn. (pary-/ava--) living farther off (= not quite near) View this entry on the original dictionary page scan.
paryavasitamfn. (with lokāntaram-) departed to View this entry on the original dictionary page scan.
paryavasitamfn. finished, concluded, ended etc. View this entry on the original dictionary page scan.
paryavasitamfn. amounting to (locative case) View this entry on the original dictionary page scan.
paryavasitamfn. resolved, settled, definitive View this entry on the original dictionary page scan.
paryavasitamatimfn. thoroughly acquainted or familiar with (locative case) View this entry on the original dictionary page scan.
paryudasitavyamfn. to be excluded or denied View this entry on the original dictionary page scan.
paṭhitasiddhamfn. effective on being (merely) recited View this entry on the original dictionary page scan.
paṭhitasiddhasārasvatastotran. Name of work View this entry on the original dictionary page scan.
pattrasif. the vein or fibre of a leaf. equals -bhaṅga- View this entry on the original dictionary page scan.
pauliśasiddhāntam. Name of astronomy work View this entry on the original dictionary page scan.
pāyasikamf(ī-)n. fond of boiled milk etc. Va1rtt. 17 View this entry on the original dictionary page scan.
payasiṣṭha mfn. superl. of payas-vin- View this entry on the original dictionary page scan.
phalasiddhif. realising an object, success, a prosperous issue on View this entry on the original dictionary page scan.
pīnasin() mfn. -having a cold View this entry on the original dictionary page scan.
pīnasita() mfn. -having a cold View this entry on the original dictionary page scan.
prabhākarasiddhim. Name of a scholar View this entry on the original dictionary page scan.
prābhasika(with kṣetra-) n. equals pra-bhāsa-kṣ- View this entry on the original dictionary page scan.
prabodhasiddhif. Name of work View this entry on the original dictionary page scan.
pracalasiṃham. Name of a poet View this entry on the original dictionary page scan.
pradīpasiṃham. Name of an author View this entry on the original dictionary page scan.
prahasitamfn. laughing, cheerful View this entry on the original dictionary page scan.
prahasitam. Name of a buddha- View this entry on the original dictionary page scan.
prahasitam. of a prince of the kiṃ-nara-s View this entry on the original dictionary page scan.
prahasitan. bursting into laughter View this entry on the original dictionary page scan.
prahasitan. displaying bright gaudy colours View this entry on the original dictionary page scan.
prahasitānanamfn. () with laughing face. View this entry on the original dictionary page scan.
prahasitanetram. "laughing-eyed", Name of a buddha- View this entry on the original dictionary page scan.
prahasitavadanamfn. () with laughing face. View this entry on the original dictionary page scan.
pramāṇasiddhim. Name of a man View this entry on the original dictionary page scan.
prasi(only A1. perfect tense siṣye-,with pass. meaning) , to bind-render harmless View this entry on the original dictionary page scan.
prasicP. -siñcati-, to pour out, shed, emit etc.,; to sprinkle, water ; to fill (a vessel) : Passive voice -sicyate-, to be poured out or flow forth ; to be watered id est refreshed : Causal -secayati-, to pour into (locative case) View this entry on the original dictionary page scan.
prasiddhamfn. (pr/a--) brought about, accomplished (a-pras-) View this entry on the original dictionary page scan.
prasiddhamfn. arranged, adorned (as hair) View this entry on the original dictionary page scan.
prasiddhamfn. well known, notorious, celebrated etc. View this entry on the original dictionary page scan.
prasiddhāf. (in music) a particular measure View this entry on the original dictionary page scan.
prasiddhakam. Name of a prince descended from janaka- (son of maru- and father of kṛtti-ratha-) View this entry on the original dictionary page scan.
prasiddhakṣatriyaprāyamfn. consisting for the most part of renowned kṣatriya-s View this entry on the original dictionary page scan.
prasiddhatāf. () celebrity, notoriety. View this entry on the original dictionary page scan.
prasiddhatvan. () celebrity, notoriety. View this entry on the original dictionary page scan.
prasiddhif. accomplishment, success, attainment View this entry on the original dictionary page scan.
prasiddhif. proof, argument View this entry on the original dictionary page scan.
prasiddhif. general opinion, publicity, celebrity, renown, fame, rumour View this entry on the original dictionary page scan.
prasiddhihatamfn. having no value, very trivial View this entry on the original dictionary page scan.
prasiddhimatmfn. universally known, famous View this entry on the original dictionary page scan.
prasiddhividyāviruddhamfn. contrary to common sense and science, View this entry on the original dictionary page scan.
prasiddhiviruddhatāf. the state of being opposed to general opinion, (equals khyāti-v-) View this entry on the original dictionary page scan.
prasidhP. A1. -sedhati-, te-, to drive on View this entry on the original dictionary page scan.
prasidhP. -sidhyati-, (rarely A1. te-), to be accomplished or effected, succeed etc. ; to result from (ablative) ; to be explained or made clear on View this entry on the original dictionary page scan.
prasiktamfn. poured out View this entry on the original dictionary page scan.
prasiktamfn. (in fine compositi or 'at the end of a compound') sprinkled with View this entry on the original dictionary page scan.
prasitamfn. (for 2.See below) bound, fastened View this entry on the original dictionary page scan.
prasitamfn. diligent, attentive, attached or devoted to, engrossed by, engaged in, occupied with (locative case or instrumental case; see ) View this entry on the original dictionary page scan.
prasitamfn. lasting, continuous View this entry on the original dictionary page scan.
prasitamfn. (2. si-; see pra-si-above) darting along View this entry on the original dictionary page scan.
prasitan. pus, matter View this entry on the original dictionary page scan.
prasitif. (pr/a--) (for 2.See below) a net for catching birds ( ) View this entry on the original dictionary page scan.
prasitif. a ligament, binding, fetter View this entry on the original dictionary page scan.
prasitif. (pr/a--) (for 1.See above) onward rush, onset, attack, assault View this entry on the original dictionary page scan.
prasitif. a throw, cast, shot, missile View this entry on the original dictionary page scan.
prasitif. stretch, reach, extension, sphere View this entry on the original dictionary page scan.
prasitif. succession, duration View this entry on the original dictionary page scan.
prasitif. dominion, power, authority, influence View this entry on the original dictionary page scan.
prasivP. -sīvyati-, to sew up View this entry on the original dictionary page scan.
praśvasitavyan. (impers.) recovery of breath id est recreation should be procured for (genitive case) or by (instrumental case) or through or by means of (instrumental case) View this entry on the original dictionary page scan.
pratāpasiṃham. Name of author View this entry on the original dictionary page scan.
pratāpasiṃharājam. Name of author View this entry on the original dictionary page scan.
prathamavayasinmfn. young View this entry on the original dictionary page scan.
prātidaivasikamf(ī-)n. (fr. -divasam-) happening or occurring daily View this entry on the original dictionary page scan.
pratirasitan. echo, resonance, View this entry on the original dictionary page scan.
pratitantrasiddhāntam. a doctrine adopted in various systems (but not in all) View this entry on the original dictionary page scan.
pratyakṣasiddhamfn. determined by evidence of the senses View this entry on the original dictionary page scan.
pratyavasitamfn. relapsed into the old (bad) way of life (Scholiast or Commentator"one who has given up the life of a religious mendicant") View this entry on the original dictionary page scan.
pratyavasitamfn. consumed, eaten (see ) View this entry on the original dictionary page scan.
pravrajyāvasitam. a religious mendicant who has renounced his order View this entry on the original dictionary page scan.
pulastyasiddhāntam. Name of work View this entry on the original dictionary page scan.
purāṇasiṃham. Name of viṣṇu- as man-lion View this entry on the original dictionary page scan.
puruṣārthasiddhyupāyam. Name of work View this entry on the original dictionary page scan.
puruṣasiṃham. "man-lion", an eminent man or hero View this entry on the original dictionary page scan.
puruṣasiṃham. (with jaina-s) Name of the 5th of the black vāsudeva-s View this entry on the original dictionary page scan.
pūrvasiddhamfn. previously settled or determined or proved View this entry on the original dictionary page scan.
pūrvasiddhāntam. Name of work View this entry on the original dictionary page scan.
pūrvasiddhāntapakṣatāf. Name of work View this entry on the original dictionary page scan.
pūrvavayasinmfn. being in the first period of life, young View this entry on the original dictionary page scan.
puṣpasif. "white like flower", a kind of sugar View this entry on the original dictionary page scan.
rābhasikamfn. (fr. rabhas-) impetuous, vehement (= āyaḥśūlika- q.v) View this entry on the original dictionary page scan.
rābhasikatāf. vehemency, impetuosity View this entry on the original dictionary page scan.
rāghavasiṃham. " rāghava-s-lion", Name of rāma--candra View this entry on the original dictionary page scan.
raghurājasiṃham. Name of an author View this entry on the original dictionary page scan.
rahasiind. rahas
rājasikamfn. equals rājasa- View this entry on the original dictionary page scan.
rājasiṃham. "king-lion", an illustrious king View this entry on the original dictionary page scan.
rājasiṃham. Name of various kings View this entry on the original dictionary page scan.
rājasiṃhapāṇḍya(), m. Name (also title or epithet) of a king. View this entry on the original dictionary page scan.
rājasiṃhasudhāsaṃgraham. Name of a medical work (written by mahādeva-, at the request of king rāja-siṃha-, and also called -sudhā-sindhu-). View this entry on the original dictionary page scan.
rājavarcasinmfn. being in royal service View this entry on the original dictionary page scan.
ramalasiktāf. (?) Name of work View this entry on the original dictionary page scan.
rāmamānasikapūjāf. Name of work View this entry on the original dictionary page scan.
rāmānujasiddhāntapadavīf. Name of work
rāmānujasiddhāntasaṃgraham. Name of work
rāmānujasiddhāntavijayam. Name of work
rāmānujīyasiddhāntam. Name of work View this entry on the original dictionary page scan.
rāmasiddhāntasaṃgraham. Name of work on bhakti-. View this entry on the original dictionary page scan.
rāmasiṃham. Name of a king (son of jaya-siṃha-) View this entry on the original dictionary page scan.
rāmasiṃhadevam. Name of a king of mithilā- and of the patron of ratneśvara- View this entry on the original dictionary page scan.
rāmasiṃhavarmanm. Name of a king of jaya-pura- (who passes as the author of the dhātu-ratnamañjarī-) View this entry on the original dictionary page scan.
raṇarasikamfn. fond of fighting, desirous of fighting with (compound) View this entry on the original dictionary page scan.
raṇoddīpasiṃham. Name of a man View this entry on the original dictionary page scan.
rasāmṛtasindhum. rasāmṛta
rasasaṃgrahasiddhāntam. Name of work View this entry on the original dictionary page scan.
rasasiddhamfn. brought to perfection by means of quicksilver, skilled in alchemy View this entry on the original dictionary page scan.
rasasiddhamfn. conversant with the poetical rasa-s, accomplished in poetry View this entry on the original dictionary page scan.
rasasiddhāntasāgaram. Name of work View this entry on the original dictionary page scan.
rasasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
rasasiddhif. perfection attained by means of quicksilver, skill in alchemy View this entry on the original dictionary page scan.
rasasiddhiprakāśam. Name of a medical work View this entry on the original dictionary page scan.
rasasindhum. Name of work View this entry on the original dictionary page scan.
rasasindūran. a sort of factitious cinnabar (used as an escharotic) View this entry on the original dictionary page scan.
raseśvarasiddhāntam. Name of work (establishing the efficacy of mercury in alchemy) View this entry on the original dictionary page scan.
rasikamf(ā-)n. tasteful, elegant View this entry on the original dictionary page scan.
rasikamf(ā-)n. having a discriminating taste, aesthetic View this entry on the original dictionary page scan.
rasikamf(ā-)n. having a taste for or a sense of, fond of, devoted to, delighting in (locative case or compound) View this entry on the original dictionary page scan.
rasikamf(ā-)n. sentimental View this entry on the original dictionary page scan.
rasikamf(ā-)n. fanciful View this entry on the original dictionary page scan.
rasikamf(ā-)n. lustful View this entry on the original dictionary page scan.
rasikam. a man full of taste or feeling (see a-r-) View this entry on the original dictionary page scan.
rasikam. a libertine View this entry on the original dictionary page scan.
rasikam. Ardea Sibirica View this entry on the original dictionary page scan.
rasikam. a horse View this entry on the original dictionary page scan.
rasikam. an elephant View this entry on the original dictionary page scan.
rasikam. unboiled juice of sugar-cane View this entry on the original dictionary page scan.
rasif. See below. View this entry on the original dictionary page scan.
rasif. an emotional wife (see compound) View this entry on the original dictionary page scan.
rasif. the juice of sugar-cane, molasses View this entry on the original dictionary page scan.
rasif. curds with sugar and spice View this entry on the original dictionary page scan.
rasif. chyle View this entry on the original dictionary page scan.
rasif. the tongue View this entry on the original dictionary page scan.
rasif. a woman's girdle (see raśanā-). View this entry on the original dictionary page scan.
rasikābhāryam. one who has a wife liable to strong emotions or feelings View this entry on the original dictionary page scan.
rasikabhūṣaṇan. Name of work View this entry on the original dictionary page scan.
rasikacandrikāf. Name of work View this entry on the original dictionary page scan.
rasikajīvanan. Name of work View this entry on the original dictionary page scan.
rasikajīvanīf. Name of work View this entry on the original dictionary page scan.
rasikaprakāśam. Name of work View this entry on the original dictionary page scan.
rasikapriyāf. Name of work View this entry on the original dictionary page scan.
rasikaramaṇan. Name of work View this entry on the original dictionary page scan.
rasikarañjanan. Name of work View this entry on the original dictionary page scan.
rasikarañjinīf. Name of work View this entry on the original dictionary page scan.
rasikasaṃjīvinīf. Name of work View this entry on the original dictionary page scan.
rasikasarvasvan. Name of work View this entry on the original dictionary page scan.
rasikatāf. View this entry on the original dictionary page scan.
rasikatvan. sense of, taste or fondness for, devotion or addiction to (locative case) View this entry on the original dictionary page scan.
rasikeśvaram. "lord or husband of a passionate wife", Name of kṛṣṇa- View this entry on the original dictionary page scan.
rasinSee a-ras-. View this entry on the original dictionary page scan.
rasinmfn. juicy, liquid (as soma-) View this entry on the original dictionary page scan.
rasinmfn. impassioned View this entry on the original dictionary page scan.
rasinmfn. having good taste, aesthetic View this entry on the original dictionary page scan.
rasitamfn. (for 2.See) sounded, resounding, uttering inarticulate sounds View this entry on the original dictionary page scan.
rasitan. a roar, scream, cry, noise, sound, thunder View this entry on the original dictionary page scan.
rasitamfn. (for 1.See) tasted View this entry on the original dictionary page scan.
rasitamfn. covered or overlaid with gold, gilded, plated View this entry on the original dictionary page scan.
rasitamfn. having taste or flavour or sentiment View this entry on the original dictionary page scan.
rasitāśinmfn. consuming or destroying by mere noise View this entry on the original dictionary page scan.
rasitavatmfn. one who has tasted etc., View this entry on the original dictionary page scan.
rasitṛmfn. (for 2.See) one who roars or bellows View this entry on the original dictionary page scan.
rasitṛmfn. (for 1.See) equals rasayitṛ-, a taster View this entry on the original dictionary page scan.
ratnasiṃham. Name of various men View this entry on the original dictionary page scan.
rāyanarasiṃhapaṇḍitam. View this entry on the original dictionary page scan.
rayapraśnasūtrasiddhāntam. Name of work View this entry on the original dictionary page scan.
rāyasiṃhotsavam. Name of a medical work by rāyasiṃha- (also called vaidyaka-sāra-saṃgraha-). View this entry on the original dictionary page scan.
retovasiktamfn. "sprinkled with seed"(said of ascetics who live on the flesh of animals killed by other animals) View this entry on the original dictionary page scan.
rodasiprāmfn. (for -pr/ā-) filling heaven and earth View this entry on the original dictionary page scan.
romakasiddhāntam. Name of romakācārya-'s siddhānta- (one of the 5 chief astronomical siddhānta-s current in the age of varāha-mihira-) View this entry on the original dictionary page scan.
romakasiddhāntam. of a modern fiction View this entry on the original dictionary page scan.
romaśasiddhāntam. Name of an astronomy work. View this entry on the original dictionary page scan.
ṛṣabhagajavilasitan. Name of a metre. View this entry on the original dictionary page scan.
rudrasiṃham. Name of various men View this entry on the original dictionary page scan.
rūpasiddhim. Name of a man View this entry on the original dictionary page scan.
rūpasiddhim. of a grammatical work View this entry on the original dictionary page scan.
sabalasiṃham. Name of a king View this entry on the original dictionary page scan.
śabarasiṃham. Name of a king (mentioned in the kathārṇava-) View this entry on the original dictionary page scan.
śabdasaṃdarbhasindhum. (see śadārnavābhidhāna-) Name of a lexicon (compiled for Sir Jones by kāśīnātha- bhaṭṭācārya-). View this entry on the original dictionary page scan.
śabdasiddhāntamañjarīf. Name of a gram. work View this entry on the original dictionary page scan.
śabdasiddhif. "correct formation or use of words", Name of various works. View this entry on the original dictionary page scan.
śabdasiddhinibandham. Name of a modern school-book. View this entry on the original dictionary page scan.
śābdikanarasiṃham. Name of a grammarian View this entry on the original dictionary page scan.
ṣaḍdarśanasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
sādhyasiddhamfn. to be still accomplished and already accomplished View this entry on the original dictionary page scan.
sādhyasiddhif. accomplishment of what has to be done View this entry on the original dictionary page scan.
sādhyasiddhif. the establishing of what has to be proved View this entry on the original dictionary page scan.
sādhyasiddhif. the success of an undertaking, accomplishment fulfilment View this entry on the original dictionary page scan.
sādhyasiddhif. proof. conclusion View this entry on the original dictionary page scan.
sādhyasiddhipādam. the fourth stage or division of a suit at law, judgement, decision View this entry on the original dictionary page scan.
ṣāḍrasikamfn. (fr. ṣaḍ-rasa-) having six tastes or flavours View this entry on the original dictionary page scan.
sahajasiddhif. Name of work View this entry on the original dictionary page scan.
sāhasaikarasikamfn. one whose only feeling or passion is cruelty, brutal, ferocious View this entry on the original dictionary page scan.
sahasiddhamfn. innate ( sahasiddhatva -tva- n.) (quot) View this entry on the original dictionary page scan.
sahasiddhatvan. sahasiddha
sāhasikamf(ī-)n. bold, daring, impetuous, rash, reckless, inconsiderate etc. View this entry on the original dictionary page scan.
sāhasikamf(ī-)n. using great force or violence, perpetrated with violence, cruel, brutal, ferocious, rapacious View this entry on the original dictionary page scan.
sāhasikamf(ī-)n. overstraining or overworking one's self View this entry on the original dictionary page scan.
sāhasikamf(ī-)n. punitive, castigatory View this entry on the original dictionary page scan.
sāhasikam. a robber, freebooter View this entry on the original dictionary page scan.
sāhasikam. Name of a cook View this entry on the original dictionary page scan.
sāhasikatāf. cruelty, ferocity, impetuosity View this entry on the original dictionary page scan.
sāhasikyan. rashness, foolhardiness, temerity View this entry on the original dictionary page scan.
sāhasikyan. violence, force View this entry on the original dictionary page scan.
sahasinmfn. powerful, mighty View this entry on the original dictionary page scan.
sāhasinmfn. rash, precipitate, inconsiderate, foolhardy View this entry on the original dictionary page scan.
sāhasinmfn. cruel, violent, ferocious View this entry on the original dictionary page scan.
śairasim. patronymic fr. śiras- gaRa bāhv-ādi-. View this entry on the original dictionary page scan.
śaivasiddhāntadīpikāf. Name of work View this entry on the original dictionary page scan.
śaivasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
śaivasiddhāntasāram. Name of work View this entry on the original dictionary page scan.
śaivasiddhāntasārāvalīf. Name of work View this entry on the original dictionary page scan.
śaivasiddhāntaśekharam. Name of work View this entry on the original dictionary page scan.
sakalasiddhif. the success of all ( sakalasiddhida -da- mfn."granting success to all") View this entry on the original dictionary page scan.
sakalasiddhimfn. possessing all perfection View this entry on the original dictionary page scan.
sakalasiddhidamfn. sakalasiddhi
sākārasiddhif. Name of work View this entry on the original dictionary page scan.
sākūtahasitan. idem or 'n. a significant or meaning smile, wanton glance ' View this entry on the original dictionary page scan.
śākyasiṃham. " śakya- lion", Name of gautama- buddha- View this entry on the original dictionary page scan.
samānaprasiddhimfn. having equal success View this entry on the original dictionary page scan.
samarasiṃham. "battle-lion", Name of an astronomer View this entry on the original dictionary page scan.
sāmasiddhamfn. accomplished in a peaceable way View this entry on the original dictionary page scan.
samasiddhāntamfn. pursuing equal objects View this entry on the original dictionary page scan.
sāmasiddhif. the art of accomplishing something in a peaceable way View this entry on the original dictionary page scan.
śambarasiddhim. See above. View this entry on the original dictionary page scan.
śāmbarasilpan. the art of jugglery, magic View this entry on the original dictionary page scan.
saṃgītasiddhāntam. Name of work View this entry on the original dictionary page scan.
saṃgrāmasiddhim. Name of an elephant View this entry on the original dictionary page scan.
saṃgrāmasiṃham. "lion in battle", Name of an official in the lower regions View this entry on the original dictionary page scan.
samīpāvasitamfn. settled down in the neighbourhood View this entry on the original dictionary page scan.
saṃkalpasiddhamfn. accomplished by mental resolve or will, one who has gained supernatural power through strength of will View this entry on the original dictionary page scan.
saṃkalpasiddhif. accomplishment of an object by (strength of) will View this entry on the original dictionary page scan.
śaṃkarasiddhim. Name of a man View this entry on the original dictionary page scan.
saṃkṣepasiddhivyavasthāf. Name of work on dharma- View this entry on the original dictionary page scan.
saṃkṣiptanirṇayasindhum. Name of work View this entry on the original dictionary page scan.
samprasic Passive voice -sicyate-, to flow out, issue View this entry on the original dictionary page scan.
samprasiddhamfn. (3. sidh-) well prepared, cooked View this entry on the original dictionary page scan.
samprasiddhif. success, good luck View this entry on the original dictionary page scan.
sāmrājyasiddhif. Name of work View this entry on the original dictionary page scan.
sāmrājyasiddhidāf. Name of the family deity of the uddālaka-s View this entry on the original dictionary page scan.
saṃskārasiddhidīpikāf. Name of work View this entry on the original dictionary page scan.
samucchvasitamfn. breathed or sighed deeply (n. used impersonally) View this entry on the original dictionary page scan.
samucchvasitan. breathing View this entry on the original dictionary page scan.
samucchvasitan. a heavy or deep sigh View this entry on the original dictionary page scan.
samullasitamfn. shining forth, gleaming, brilliant, beautiful View this entry on the original dictionary page scan.
samullasitamfn. sportive, sporting View this entry on the original dictionary page scan.
samyagvyavasitamfn. firmly resolved View this entry on the original dictionary page scan.
sānasimfn. bringing wealth or blessings, laden with spoils, victorious View this entry on the original dictionary page scan.
sanātanasiddhāntam. Name of work View this entry on the original dictionary page scan.
saptasif. betel (wrong reading -śirā-). View this entry on the original dictionary page scan.
sarasi(locative case of saras-), in compound View this entry on the original dictionary page scan.
sārasiddhāntakaumudīf. Name of work View this entry on the original dictionary page scan.
sarasijamfn. produced or living in lakes or ponds (as fish) View this entry on the original dictionary page scan.
sarasijan. a lotus View this entry on the original dictionary page scan.
sarasijākṣīf. a lotus-eyed woman, View this entry on the original dictionary page scan.
sarasijamukhīf. a lotus-faced woman, View this entry on the original dictionary page scan.
sarasikam. the Indian crane (also sarasīka-; see sārasa-) View this entry on the original dictionary page scan.
sarasika sarasi-ja- etc. See p.1182. View this entry on the original dictionary page scan.
sārasif. a female Indian crane View this entry on the original dictionary page scan.
sarasiñanmanm. "lotus-born", Name of brahmā- View this entry on the original dictionary page scan.
sārasindhum. Name of work View this entry on the original dictionary page scan.
sarasiruhan. "growing in a lake or pond", a lotus View this entry on the original dictionary page scan.
sarasiruhajanmanm. "lotus-born", Name of brahmā- View this entry on the original dictionary page scan.
sarasiruhasūnum. "lotus-son" idem or 'm. "lotus-born", Name of brahmā- ' View this entry on the original dictionary page scan.
śaratparvaśasinm. śaratparvan
sarvārthasiddhamfn. one who has accomplished all aims View this entry on the original dictionary page scan.
sarvārthasiddham. Name of gautama- buddha- (so called, according to some, because his parents' wishes were all fulfilled by his birth) View this entry on the original dictionary page scan.
sarvārthasiddham. of a king View this entry on the original dictionary page scan.
sarvārthasiddhif. accomplishment of all aims View this entry on the original dictionary page scan.
sarvārthasiddhif. Name of various works. View this entry on the original dictionary page scan.
sarvārthasiddhim. plural (with jaina-s) a class of deities View this entry on the original dictionary page scan.
sarvasampradāyābhedasiddhāntam. Name of work View this entry on the original dictionary page scan.
sarvasiddhāf. Name of the 4th and 9th and 14th lunar nights. View this entry on the original dictionary page scan.
sarvasiddhāntam. Name of work View this entry on the original dictionary page scan.
sarvasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
sarvasiddhārthamfn. having every object accomplished, having every wish gratified View this entry on the original dictionary page scan.
sarvasiddhif. accomplishment of every object, universal success View this entry on the original dictionary page scan.
sarvasiddhif. entire proof, complete result View this entry on the original dictionary page scan.
sarvasiddhim. Aegle Marmelos View this entry on the original dictionary page scan.
sarvatantrasiddhāntam. a dogma admitted by all systems (opp. to pratitantra-s- q.v) View this entry on the original dictionary page scan.
sarvavedasinmfn. giving away all one's property View this entry on the original dictionary page scan.
sasiddhācāryam. Name of a teacher View this entry on the original dictionary page scan.
śasitaSee vi-ś-. View this entry on the original dictionary page scan.
sasitamfn. with sugar View this entry on the original dictionary page scan.
sasitopalamfn. idem or 'mfn. with sugar ' View this entry on the original dictionary page scan.
sasitotpalamālinmfn. wreathed with white lotus flowers View this entry on the original dictionary page scan.
śasitṛSee vi-ś-. View this entry on the original dictionary page scan.
śasitvāind. having praised etc. (equals śastvā-See śaṃs-) View this entry on the original dictionary page scan.
śasitvāind. having wounded or hurt View this entry on the original dictionary page scan.
śāstrasiddhamfn. established by the śāstra- View this entry on the original dictionary page scan.
śāstrasiddhāntaleśasaṃgraham. Name of work View this entry on the original dictionary page scan.
śāstrasiddhāntaleśasaṃgrahasāram. Name of work View this entry on the original dictionary page scan.
satkāryavādasiddhāntam. satkāryavāda
satpratipakṣasiddhāntagranthadīdhitiṭīkāf. Name of work View this entry on the original dictionary page scan.
satpratipakṣasiddhāntagranthaṭīkāf. Name of work View this entry on the original dictionary page scan.
satpratipakṣasiddhāntakroḍam. Name of work View this entry on the original dictionary page scan.
satpratipakṣasiddhāntānugamam. Name of work View this entry on the original dictionary page scan.
satpratipakṣasiddhāntarahasyan. Name of work View this entry on the original dictionary page scan.
sattarkasiddhāñjanan. Name of work View this entry on the original dictionary page scan.
sātvatasiddhāntaśatakan. Name of a vedānta- work View this entry on the original dictionary page scan.
saurasiddhāntam. Name of work View this entry on the original dictionary page scan.
sauyavasim. a patronymic View this entry on the original dictionary page scan.
śavasinmfn. idem or 'mfn. mighty, powerful ' View this entry on the original dictionary page scan.
savyabhicārasiddhāntagranthadīdhitiṭīkāf. Name of work View this entry on the original dictionary page scan.
savyabhicārasiddhāntagranthalokam. Name of work View this entry on the original dictionary page scan.
savyabhicārasiddhāntagranthaprakāśam. Name of work View this entry on the original dictionary page scan.
savyabhicārasiddhāntagrantharahasyan. Name of work View this entry on the original dictionary page scan.
savyabhicārasiddhāntagranthaṭīkāf. Name of work View this entry on the original dictionary page scan.
siddhāntasiddhāñjanan. Name of work View this entry on the original dictionary page scan.
siddhāntasindhum. Name of work View this entry on the original dictionary page scan.
siddhasiddhamfn. thoroughly efficacious (said of a particular mantra-) View this entry on the original dictionary page scan.
siddhasiddhāñjanan. Name of work View this entry on the original dictionary page scan.
siddhasiddhāntam. Name of work View this entry on the original dictionary page scan.
siddhasiddhāntapaddhatif. Name of work View this entry on the original dictionary page scan.
siddhasindhum. "river of the siddha-s", Name of the heavenly Ganges. View this entry on the original dictionary page scan.
siddhyasiddhif. dual number success and misfortune View this entry on the original dictionary page scan.
simasimāya (onomatopoetic (i.e. formed from imitation of sounds)) A1. yate-, to bubble, simmer, crackle View this entry on the original dictionary page scan.
siṃhasiddhāntasindhum. Name of work View this entry on the original dictionary page scan.
śirasi locative case of śiras-, in compound View this entry on the original dictionary page scan.
śirasijam. (in fine compositi or 'at the end of a compound' f(ā-).) "produced on the head", the hair of the head View this entry on the original dictionary page scan.
śirasijapāśam. a tuft of hair View this entry on the original dictionary page scan.
śirasiruh() () m. "growing on the head", the hair. View this entry on the original dictionary page scan.
śirasiruha() m. "growing on the head", the hair. View this entry on the original dictionary page scan.
śirasisicf. a head-cloth View this entry on the original dictionary page scan.
śirasitamfn. exalted (?) View this entry on the original dictionary page scan.
śītarasikamfn. having or causing a cold flavour View this entry on the original dictionary page scan.
sitasiddhārtha m. white mustard (or a grain of white mustard-seed) View this entry on the original dictionary page scan.
sitasiddhārthakam. white mustard (or a grain of white mustard-seed) View this entry on the original dictionary page scan.
sitasiṃhīf. a white-blossomed kaṇṭakārī- View this entry on the original dictionary page scan.
sitasindhuf. the Ganges View this entry on the original dictionary page scan.
sitasiva varia lectio for -śiva- View this entry on the original dictionary page scan.
śivādvaitasiddhāntaprakāśikāf. Name of work View this entry on the original dictionary page scan.
śivamānasikasnānan. Name of work View this entry on the original dictionary page scan.
śivaprakāsakasiṃha m. Name of the author of the bhāgavata-tattva-bhāskara-. View this entry on the original dictionary page scan.
śivasiddhāntam. (also śivasiddhāntaśāstra -śāstra- n.) Name of an astrology work View this entry on the original dictionary page scan.
śivasiddhāntaśāstran. śivasiddhānta
śivasiṃham. (also -deva-) Name of various princes (especially of a king of mithilā-, brother of padma-siṃha-, and patron of vidyā-pati-)
śmasiin See vaś-. View this entry on the original dictionary page scan.
somasiddhāntam. a particular heretical tantra- system (followed by a sect of śaiva-s and personified in the 3rd Act of the prabodha-candrodaya-) View this entry on the original dictionary page scan.
somasiddhāntam. Name of various astronomical works View this entry on the original dictionary page scan.
somasiddhāntam. of a particular buddha- View this entry on the original dictionary page scan.
somasiddhāntinm. a follower of the above system View this entry on the original dictionary page scan.
somasindhum. "ocean of soma-", Name of viṣṇu- View this entry on the original dictionary page scan.
sotkṛṣṭahasitasvaramfn. accompanied by loud laughter View this entry on the original dictionary page scan.
sotprāsahasitan. derisive or sarcastic laughter View this entry on the original dictionary page scan.
sparśarasikamfn. fond of sensation, sensual, lustful, View this entry on the original dictionary page scan.
sphuṭasiddhāntam. Name of an astronomy work View this entry on the original dictionary page scan.
śrāddhavasiṣṭhamn. Name of work View this entry on the original dictionary page scan.
śramasiddhamfn. accomplished by exertion or labour View this entry on the original dictionary page scan.
śrautasiddhāntam. Name of work View this entry on the original dictionary page scan.
śreyasitarā f. a more excellent woman View this entry on the original dictionary page scan.
śṛṅgārasiṃham. Name of a man View this entry on the original dictionary page scan.
sthaṇḍilasitakan. an altar (equals vedi-) View this entry on the original dictionary page scan.
sthūlasiktan. Name of a tīrtha- View this entry on the original dictionary page scan.
sundarasiddhāntam. Name of work View this entry on the original dictionary page scan.
suparyavasitamfn. well carried out View this entry on the original dictionary page scan.
suparyavasitārthamfn. thoroughly acquainted with anything View this entry on the original dictionary page scan.
sūpasiddhamfn. well-seasoned, made savoury or relishable View this entry on the original dictionary page scan.
suprasiddhamfn. well known View this entry on the original dictionary page scan.
suprasiddhapadamañjarīf. Name of work View this entry on the original dictionary page scan.
supratyavasitamfn. (perhaps) safely returned to one's own country View this entry on the original dictionary page scan.
śūrasiṃham. Name of an author View this entry on the original dictionary page scan.
surasindhuf. equals -sarit- View this entry on the original dictionary page scan.
surasindhuf. equals mandākinī- (Scholiast or Commentator) View this entry on the original dictionary page scan.
sūratasiṃham. Name of a king (patron of śrī-nivāsa- bhaṭṭa-) View this entry on the original dictionary page scan.
sūryasiddhāntam. a celebrated astronomical text-book (said to be a direct revelation from the Sun) View this entry on the original dictionary page scan.
sūryasiddhāntam. of another work View this entry on the original dictionary page scan.
sūryasiddhāntabhāṣyan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntadīpikāf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntamañjarīf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntapradīpikāf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntaprakāśam. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntarahasyan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntasāraṇīf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntaṭīkāf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntavāsanābhāṣyan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntavyākhyāf. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntavyākhyānan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntavyākhyāvivaraṇan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiddhāntodāharaṇan. Name of Comm. View this entry on the original dictionary page scan.
sūryasiṃham. Name of a king View this entry on the original dictionary page scan.
sūtakasiddhāntam. Name of work View this entry on the original dictionary page scan.
suvarcasinm. Name of śiva- (see prec.) View this entry on the original dictionary page scan.
suvarcasinm. natron, alkali View this entry on the original dictionary page scan.
suvarṇasiddham. an adept in acquiring gold by magical means View this entry on the original dictionary page scan.
suyavasinmfn. having good pasturage View this entry on the original dictionary page scan.
svabhāvasiddhamfn. established by nature, natural, innate View this entry on the original dictionary page scan.
svabhāvasiddhamfn. self-evident, obvious View this entry on the original dictionary page scan.
svārājyasiddhif. Name of a vedānta- work View this entry on the original dictionary page scan.
svarasiddhāntacandrikāf. Name of work View this entry on the original dictionary page scan.
svarasiddhāntakaumudīf. Name of work View this entry on the original dictionary page scan.
svarasiddhāntamañjarīf. Name of work View this entry on the original dictionary page scan.
svārasikamfn. (fr. sva-rasa-) possessing inherent flavour or sweetness (as a poem etc.) View this entry on the original dictionary page scan.
svārasikamfn. natural, self-evident View this entry on the original dictionary page scan.
svarasiṃham. Name of work View this entry on the original dictionary page scan.
svarṇasindūram. a particular medicinal preparation View this entry on the original dictionary page scan.
svārthasiddhif. (equals sādhana-) View this entry on the original dictionary page scan.
svasicmfn. pouring out spontaneously (see su-s/ic-). View this entry on the original dictionary page scan.
svasiddhamfn. spontaneously effected View this entry on the original dictionary page scan.
svasiddhamfn. naturally one's own, belonging to one's self by nature View this entry on the original dictionary page scan.
śvasitamfn. breathed, sighed etc. View this entry on the original dictionary page scan.
śvasitamfn. possessed of breath or life, vivified, revived
śvasitan. breathing, breath, respiration, sighing, a sigh View this entry on the original dictionary page scan.
svasitamfn. very black (in yata-locana-,"having very black and long eyes"), mal-. View this entry on the original dictionary page scan.
śvetasiddham. Name of one of skanda-'s attendants View this entry on the original dictionary page scan.
śvetasiṃhīf. a kind of pot-herb View this entry on the original dictionary page scan.
tāmasikamfn. relating to the quality tamas- (q.v) View this entry on the original dictionary page scan.
asitiind. idem or 'ind. (sad-iti-) ' View this entry on the original dictionary page scan.
tejasiṃham. Name of a man (son of raṇa-dara-) View this entry on the original dictionary page scan.
tejasiṃham. see jaḥ-s-. View this entry on the original dictionary page scan.
tilakasiṃhan. Name of a man View this entry on the original dictionary page scan.
tṛṇasiṃham. "reed-lion", axe View this entry on the original dictionary page scan.
tulasimetrically for - View this entry on the original dictionary page scan.
tulasif. equals -, View this entry on the original dictionary page scan.
ucchvasitamfn. heaving, beating, breathed, inspired View this entry on the original dictionary page scan.
ucchvasitamfn. recovered, calm View this entry on the original dictionary page scan.
ucchvasitamfn. revived, refreshed, gladdened etc. View this entry on the original dictionary page scan.
ucchvasitamfn. heaving, swelling up, raised, lifted etc. View this entry on the original dictionary page scan.
ucchvasitamfn. expanded, burst, unfastened, untied View this entry on the original dictionary page scan.
ucchvasitamfn. blooming View this entry on the original dictionary page scan.
ucchvasitan. breathing out, respiration View this entry on the original dictionary page scan.
ucchvasitan. exhalation View this entry on the original dictionary page scan.
ucchvasitan. breath View this entry on the original dictionary page scan.
ucchvasitan. throbbing, sighing View this entry on the original dictionary page scan.
ucchvasitan. bursting View this entry on the original dictionary page scan.
ucchvasitan. unfastening, untying View this entry on the original dictionary page scan.
udavasitan. a house, dwelling View this entry on the original dictionary page scan.
udayasiṃham. Name of a king. View this entry on the original dictionary page scan.
ujjvalanarasiṃham. Name of a tīrtha- . View this entry on the original dictionary page scan.
ullasitamfn. shining, bright, brilliant View this entry on the original dictionary page scan.
ullasitamfn. coming forth, rising, appearing View this entry on the original dictionary page scan.
ullasitamfn. ejected, brought out View this entry on the original dictionary page scan.
ullasitamfn. drawn, unsheathed (as a sword) View this entry on the original dictionary page scan.
ullasitamfn. merry, happy, joyful View this entry on the original dictionary page scan.
ullasitamfn. moving, trembling. View this entry on the original dictionary page scan.
upahasitamfn. laughed at, derided View this entry on the original dictionary page scan.
upahasitan. laughter accompanied by shaking the head (sa-śiraḥ-kampam-) View this entry on the original dictionary page scan.
upasicP. -siñcati-, to pour upon, sprinkle View this entry on the original dictionary page scan.
upasicya ind.p. pouring on, sprinkling View this entry on the original dictionary page scan.
upasiddhamfn. (3. sidh-) ready, prepared (food; confer, compare - pasiddha-), View this entry on the original dictionary page scan.
upasidhP. (imperfect tense -asedhat-) to keep off View this entry on the original dictionary page scan.
upasiktamfn. sprinkled with View this entry on the original dictionary page scan.
upāvasitamfn. settled or abiding near by View this entry on the original dictionary page scan.
urasi(in compound for /uras-above) . View this entry on the original dictionary page scan.
urasijam. "produced on the chest", the female breast
urasikṛtyaSee /uras- above. View this entry on the original dictionary page scan.
urasilamfn. having a full or broad breast, broad-chested gaRa picchādi- View this entry on the original dictionary page scan.
urasilomanmfn. having hair on the breast commentator or commentary on View this entry on the original dictionary page scan.
urasiruham. idem or 'm. "produced on the chest", the female breast ' View this entry on the original dictionary page scan.
ūṣasikatan. granular salt View this entry on the original dictionary page scan.
vādībhasiṃham. Name of a jaina- View this entry on the original dictionary page scan.
vāgasim. "speech-sword", sharp or cutting speech View this entry on the original dictionary page scan.
vaidikasiddhāntam. Name of work View this entry on the original dictionary page scan.
vaidyanarasiṃhasenam. Name of a scholiast View this entry on the original dictionary page scan.
vaidyasika wrong reading for vaighasika- View this entry on the original dictionary page scan.
vaidyasiṃhīf. Gendarussa Vulgaris View this entry on the original dictionary page scan.
vaighasikamfn. feeding on the residue or remains of food View this entry on the original dictionary page scan.
vaikhānasim. a patronymic View this entry on the original dictionary page scan.
vaiṣṇavasiddhāntadīpikāf. Name of work View this entry on the original dictionary page scan.
vaiṣṇavasiddhāntatattvan. Name of work View this entry on the original dictionary page scan.
vaiṣṇavasiddhāntavaijayantīf. Name of work View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntabhūṣaṇan. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntabhūṣaṇasāram. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntadīpikāf. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntakaumudīf. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntamañjūṣāf. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntamañjūṣāsāram. View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntarahasyan. Name of work View this entry on the original dictionary page scan.
vaiyākaraṇasiddhāntaratnākaram. Name of work View this entry on the original dictionary page scan.
vajrasiṃham. Name of a king View this entry on the original dictionary page scan.
vakṣasijam. equals vakṣo-ja- View this entry on the original dictionary page scan.
vākyakaraṇasiddhāntam. Name of work View this entry on the original dictionary page scan.
vākyasiddhāntastotran. Name of work View this entry on the original dictionary page scan.
vallabhasiddhāntaṭīkāf. Name of work on bhakti-. View this entry on the original dictionary page scan.
vanakārpasi() f. the wild cotton tree. View this entry on the original dictionary page scan.
vanasindhuram. equals -karin- View this entry on the original dictionary page scan.
varcasinSee brahma-- and su-v- View this entry on the original dictionary page scan.
vārimasi(more correctly -maṣi-) f. "water-ink", a rainy cloud View this entry on the original dictionary page scan.
varivasitamfn. equals varivasyita- View this entry on the original dictionary page scan.
varṇasim. or f. (?) water View this entry on the original dictionary page scan.
vasim. or f. (for 2.See column 3) equals vastra-, clothes etc. View this entry on the original dictionary page scan.
vasim. (for 1.See column 1) dwelling or a dwelling-place View this entry on the original dictionary page scan.
vasikamfn. empty (see vaśika-, vaśin-) View this entry on the original dictionary page scan.
vasikamfn. one who sits in the padmāsana- posture View this entry on the original dictionary page scan.
vasinm. (fr. vasā-) an otter View this entry on the original dictionary page scan.
vasiram. Scindapsus Officinalis (n. its fruit) (varia lectio vasīra-and vaśira-) View this entry on the original dictionary page scan.
vasiram. Achyranthes Aspera View this entry on the original dictionary page scan.
vasiran. sea salt (varia lectio vaśira-and vaśīra-) View this entry on the original dictionary page scan.
vasiṣṭhamfn. (superl. fr. 1. v/asu-; see v/asīyas-and under3. vas-) most excellent, best, richest View this entry on the original dictionary page scan.
vasiṣṭham. (wrongly written vaśiṣṭha-),"the most wealthy", Name of a celebrated Vedic ṛṣi- or sage (owner of the"cow of plenty" , called nandinī-, offspring of surabhi-, which by granting all desires made him, as his name implies, master of every vasu-or desirable object;he was the typical representative of Brahmanical rank, and the legends of his conflict with viśvā-mitra-, who raised himself from the kingly or kṣatriya- to the Brahmanical class, were probably founded on the actual struggles which took place between the Brahmans and kṣatriya-s;a great many hymns of the are ascribed to these two great rivals;those of the seventh maṇḍala-, besides some others, being attributed to vasiṣṭha-, while those of the third maṇḍala- are assigned to viśvā-mitra-;in one of vasiṣṭha-'s hymns he is represented as king su-dās-'s family priest, an office to which viśvā-mitra- also aspired;in another hymn vasiṣṭha- claims to have been inspired by varuṇa-, and in another[ ] he is called the son of the apsaras- urvaśī- by mitra- and varuṇa-, whence his patronymic maitrāvaruṇi-;in manu- , he is enumerated among the ten prajā-pati-s or Patriarchs produced by manu- svāyambhuva- for the peopling of the universe;in the he is mentioned as the family priest of the solar race or family of ikṣvāku- and rāma-candra-, and in the purāṇa-s as one of the arrangers of the veda-s in the dvāpara- age;he is, moreover, called the father of aurva-[ ],of the sukālin-s[ ],of seven sons[ ] , and the husband of akṣa-mālā- or arundhatī-[ ]and of ūrjā-[ ];other legends make him one of the 7 patriarchal sages regarded as forming the Great Bear in which he represents the starSee ṛṣi-) etc. (see )
vasiṣṭham. Name of the author of a law-book and other works (prob. intended to be ascribed to the Vedic ṛṣi- above) View this entry on the original dictionary page scan.
vasiṣṭham. plural the family of vasiṣṭha- (vasiṣṭhasyāṅkuśaḥ-etc.Name of sāman-s ) View this entry on the original dictionary page scan.
vasiṣṭham. Name of an anuvāka- on Va1rtt. 2 View this entry on the original dictionary page scan.
vasiṣṭhan. flesh View this entry on the original dictionary page scan.
vasiṣṭha vasīyas- See p.930. View this entry on the original dictionary page scan.
vasiṣṭhabhṛgvatrisamamfn. equal to (the three great saints) vasiṣṭha- and bhṛgu- and atri- View this entry on the original dictionary page scan.
vasiṣṭhahomaprakāram. Name of work View this entry on the original dictionary page scan.
vasiṣṭhakam. the sage vasiṣṭha- (See above) . View this entry on the original dictionary page scan.
vasiṣṭhakālpam. Name of work View this entry on the original dictionary page scan.
vasiṣṭhakaśyapikāf. a matrimonial alliance between the descendants of vasiṣṭha- and those of kaśyapa- View this entry on the original dictionary page scan.
vasiṣṭhaliṅgapurāṇan. Name of a purāṇa-. View this entry on the original dictionary page scan.
vasiṣṭhanihavam. Name of a sāman-, View this entry on the original dictionary page scan.
vasiṣṭhaprācīf. Name of a place View this entry on the original dictionary page scan.
vasiṣṭhapramukhamfn. preceded or led by vasiṣṭha- View this entry on the original dictionary page scan.
vasiṣṭhaputram. plural "the sons or descendants of vasiṣṭha-", Name of the authors of View this entry on the original dictionary page scan.
vasiṣṭhasaṃhitāf. View this entry on the original dictionary page scan.
vasiṣṭhasaṃsarpam. a particular catur-aha-, View this entry on the original dictionary page scan.
vasiṣṭhaśapham. dual number Name of a sāman- View this entry on the original dictionary page scan.
vasiṣṭhasiddhāntam. View this entry on the original dictionary page scan.
vāsiṣṭhasiddhāntam. Name of work View this entry on the original dictionary page scan.
vasiṣṭhaśikṣāf. Name of a śikṣā-. View this entry on the original dictionary page scan.
vasiṣṭhaśilāf. Name of a place View this entry on the original dictionary page scan.
vasiṣṭhasmṛtif. View this entry on the original dictionary page scan.
vasiṣṭhaśrāddhakalpam. Name of work View this entry on the original dictionary page scan.
vasiṣṭhatantran. Name of a tantra-. View this entry on the original dictionary page scan.
vasiṣṭhatvan. the state or condition of being vasiṣṭha- View this entry on the original dictionary page scan.
vasiṣṭhavatind. like vasiṣṭha- View this entry on the original dictionary page scan.
vasiṣṭhayajña(v/a-) m. Name of a particular sacrifice View this entry on the original dictionary page scan.
vasiṣṭhopapurāṇan. Name of an upapurāṇa-. View this entry on the original dictionary page scan.
vasitamfn. (for 2.See column 3) worn, put on View this entry on the original dictionary page scan.
vasitan. cloth View this entry on the original dictionary page scan.
vasitamfn. (for 1.See column 1) = 2. uṣita-, inhabiting etc. View this entry on the original dictionary page scan.
vasitamfn. stored (as grain) View this entry on the original dictionary page scan.
vasitan. abiding, abode, residence View this entry on the original dictionary page scan.
vasitavyamfn. to be worn or put on View this entry on the original dictionary page scan.
vasitṛmfn. one who wears or puts on ( vasitṛtama -tama- mfn. equals ācchādayitṛ-tama-,used to explain vasiṣṭha-) on View this entry on the original dictionary page scan.
vasitṛtamamfn. vasitṛ
vaṭeśvarasiddhāntam. Name of work View this entry on the original dictionary page scan.
vayasinSee pūrva-- and prathama-v-. View this entry on the original dictionary page scan.
vedāntasārasiddhāntatātparyan. Name of work View this entry on the original dictionary page scan.
vedāntasiddhāntam. Name of work ( vedāntasiddhāntakaumudī ta-kaumudī- f. vedāntasiddhāntacandrikā -candrikā- f. vedāntasiddhāntadīpikā -dīpikā- f. vedāntasiddhāntapradīpa -pradīpa- m. vedāntasiddhāntabheda -bheda- m. vedāntasiddhāntamuktāvalī -muktāvalī- f. vedāntasiddhāntaratnāñjali -ratnāñjali- m. vedāntasiddhāntasūktimañjarīprakāśa -kti-mañjarī-prakāśa- m.) View this entry on the original dictionary page scan.
vedāntasiddhāntabhedam. vedāntasiddhānta
vedāntasiddhāntacandrikāf. vedāntasiddhānta
vedāntasiddhāntadīpikāf. vedāntasiddhānta
vedāntasiddhāntakaumudīf. vedāntasiddhānta
vedāntasiddhāntamuktāvalīf. vedāntasiddhānta
vedāntasiddhāntapradīpam. vedāntasiddhānta
vedāntasiddhāntaratnāñjalim. vedāntasiddhānta
vedāntasiddhāntasūktimañjarīprakāśam. vedāntasiddhānta
vedāntasiṃham. Name of work (equals -śata-ślokī-), View this entry on the original dictionary page scan.
vedasif. Name of a river (varia lectio vetasinī-). View this entry on the original dictionary page scan.
vetālasiddhif. the supernatural power of a vetāla-, View this entry on the original dictionary page scan.
vetasif. Name of a place View this entry on the original dictionary page scan.
vetasif. Name of a river (see vedasinī-). View this entry on the original dictionary page scan.
vibhūrasim. (literally"thou art mighty") a form of agni- or the god of fire View this entry on the original dictionary page scan.
vicakṣaṇacanasitavatmfn. accompanied by the word vicakṣaṇa-, or canasita- View this entry on the original dictionary page scan.
vicitrasiṃham. Name of a man View this entry on the original dictionary page scan.
viḍḍasiṃham. Name of a man View this entry on the original dictionary page scan.
vidyāmātrasiddhif. View this entry on the original dictionary page scan.
vidyāmātrasiddhitridaśaśāstrakārikāf. Name of Buddhist works. View this entry on the original dictionary page scan.
vighātanasiddhif. the settling or removal of obstacles or impediments View this entry on the original dictionary page scan.
vighnasiddhif. the settling or removal of obstacles View this entry on the original dictionary page scan.
vihasitamfn. laughing, smiling View this entry on the original dictionary page scan.
vihasitamfn. laughed, smiled at View this entry on the original dictionary page scan.
vihasitan. laughter, laughing, smiling View this entry on the original dictionary page scan.
vihasitikāSee hasatikā-. View this entry on the original dictionary page scan.
vijayagovindasiṃham. Name of authors View this entry on the original dictionary page scan.
vijayasiddhif. accomplishment of victory, success View this entry on the original dictionary page scan.
vijayasiṃham. Name of various kings View this entry on the original dictionary page scan.
vikasitamfn. () opened, open, expanded, budded, blown etc. View this entry on the original dictionary page scan.
vikasitakumudendīvarālokinmfn. looking like the expanded white and blue lotus View this entry on the original dictionary page scan.
vikasitanayanavadanakamalamfn. opening (her) lotus-like eyes and mouth View this entry on the original dictionary page scan.
vikasitavadanamfn. with opened mouth View this entry on the original dictionary page scan.
vikramasiṃham. Name of a king of ujjayinī- View this entry on the original dictionary page scan.
vikramasiṃham. of a king of ujjayinī- View this entry on the original dictionary page scan.
vilasitamfn. gleaming, glittering, shining forth, appearing View this entry on the original dictionary page scan.
vilasitamfn. played, sported (n. also impersonal or used impersonally) View this entry on the original dictionary page scan.
vilasitamfn. moving to and fro View this entry on the original dictionary page scan.
vilasitan. flashing, quivering (of lightning) View this entry on the original dictionary page scan.
vilasitan. appearing, manifestation (vidyā-, v-manifestation of knowledge) View this entry on the original dictionary page scan.
vilasitan. sport play, pastime, dalliance View this entry on the original dictionary page scan.
vilasitan. any action or gesture View this entry on the original dictionary page scan.
viniśvasitan. exhalation View this entry on the original dictionary page scan.
vinodarasikamfn. given or addicted to pleasure View this entry on the original dictionary page scan.
vipravasitamfn. withdrawn, departed (n. impersonal or used impersonally) View this entry on the original dictionary page scan.
vīraśaivasiddhāntam. Name of work View this entry on the original dictionary page scan.
vīraśaivasiddhāntaśikhāmaṇim. Name of work View this entry on the original dictionary page scan.
vīrasiṃham. Name of various kings and authors View this entry on the original dictionary page scan.
vīrasiṃhadevam. Name of the patron of mitra-- miśra- View this entry on the original dictionary page scan.
vīrasiṃhamitrodayesaṃskāraprakaraṇan. Name of work View this entry on the original dictionary page scan.
vīrasiṃhaśivendrapūjākārikāf. Name of work View this entry on the original dictionary page scan.
vīrasiṃhāvalokam. Name of work View this entry on the original dictionary page scan.
vīrasiṃhāvalokanan. Name of work View this entry on the original dictionary page scan.
viruddhasiddhāntagranthālokam. Name of work View this entry on the original dictionary page scan.
viruddhasiddhāntagrantharahasyan. Name of work View this entry on the original dictionary page scan.
viruddhasiddhāntagranthaṭīkāf. Name of work View this entry on the original dictionary page scan.
viśasi gaRa brāhmaṇādi- () View this entry on the original dictionary page scan.
viśasitamfn. cut up, dissected View this entry on the original dictionary page scan.
viśasitṛm. one who cuts up, a dissector View this entry on the original dictionary page scan.
viśeṣocchvasitan. the peculiar breath or life (cherished object), a peculiar treasure (applied to an object especially dear) View this entry on the original dictionary page scan.
viśiṣṭādvaitasiddhāntam. Name of work View this entry on the original dictionary page scan.
viṣṇuguptasiddhāntam. Name of work View this entry on the original dictionary page scan.
viṣṇurāmasiddhāntavāgīśam. Name of authors View this entry on the original dictionary page scan.
visraṃsraṃsitasitāṃśukamfn. one whose white garment has slipped down View this entry on the original dictionary page scan.
viśrotasif. equals pramāda- View this entry on the original dictionary page scan.
viśuddhasiṃham. Name of a man View this entry on the original dictionary page scan.
viśvakarmasiddhāntam. Name of work View this entry on the original dictionary page scan.
viśvanāthasiṃham. Name of author. View this entry on the original dictionary page scan.
viśvanāthasiṃhadevam. Name of author. View this entry on the original dictionary page scan.
viśvapādasirogrīvamfn. one whose feet and head and neck are formed of the universe View this entry on the original dictionary page scan.
viśvasiṃham. Name of a king View this entry on the original dictionary page scan.
viśvasitamfn. full of confidence, fearless, unsuspecting View this entry on the original dictionary page scan.
viśvasitamfn. trusted, believed or confided in View this entry on the original dictionary page scan.
viśvasitavyamfn. equals śvasanīya- View this entry on the original dictionary page scan.
vivādasindhum. Name of work View this entry on the original dictionary page scan.
vivāhasiddhāntarahasyan. Name of work View this entry on the original dictionary page scan.
vivekasārasindhum. Name of work View this entry on the original dictionary page scan.
vivekasindhum. Name of work View this entry on the original dictionary page scan.
vorasiddhiSee bora-s-. View this entry on the original dictionary page scan.
vṛddhavasiṣṭham. the older vasiṣṭha- or an older recension of vṛddha-'s law-book View this entry on the original dictionary page scan.
vṛndasindhum. Name of medical work View this entry on the original dictionary page scan.
vyadhyasiramfn. vyadhya
vyākaraṇasiddhamfn. established by grammar, grammatical View this entry on the original dictionary page scan.
vyāsādipañcasiddhāntam. plural Name of work View this entry on the original dictionary page scan.
vyāsasiddhāntam. Name of work View this entry on the original dictionary page scan.
vyasimfn. swordless View this entry on the original dictionary page scan.
vyasi vy-asu- etc. See .
vyavasitamfn. finished, ended, done View this entry on the original dictionary page scan.
vyavasitamfn. decided, determined, resolved, undertaken (also n. impersonal or used impersonally;with dative case or infinitive mood) etc. View this entry on the original dictionary page scan.
vyavasitamfn. one who has resolved upon or is determined or willing to (locative case, dative case,or infinitive mood) View this entry on the original dictionary page scan.
vyavasitamfn. settled, ascertained, known (n. impersonal or used impersonally), convinced or sure of anything (with samyak-,"one who has ascertained what is right";with accusative,"one who has acknowledged anything as true") View this entry on the original dictionary page scan.
vyavasitamfn. deceived, tricked, cheated, disappointed View this entry on the original dictionary page scan.
vyavasitamfn. energetic, persevering, making effort or exertion View this entry on the original dictionary page scan.
vyavasitan. resolution, determination View this entry on the original dictionary page scan.
vyavasitan. an artifice, contrivance View this entry on the original dictionary page scan.
vyavasitavaseyan. (impersonal or used impersonally) it is to be settled or determined View this entry on the original dictionary page scan.
vyavasitavasitif. ascertainment, determination, resolution View this entry on the original dictionary page scan.
yajñasiddhāntasaṃgraham. Name of work View this entry on the original dictionary page scan.
yajñasiddhāntavigraham. Name of work View this entry on the original dictionary page scan.
yajñasiddhif. Name of work View this entry on the original dictionary page scan.
yaśasinmfn. See deva-- and manuṣya-yaśas/in-. View this entry on the original dictionary page scan.
yathāvyavasitamind. as has been determined View this entry on the original dictionary page scan.
yāvasikam. a mower of grass View this entry on the original dictionary page scan.
yavasinSee -yavas/in-, -yavasy/u-. View this entry on the original dictionary page scan.
yogasiddhamfn. perfected by means of Yoga View this entry on the original dictionary page scan.
yogasiddham. Name of an author View this entry on the original dictionary page scan.
yogasiddhāf. Name of a sister of bṛhas-pati- View this entry on the original dictionary page scan.
yogasiddhāntacandrikāf. Name of work View this entry on the original dictionary page scan.
yogasiddhāntapaddhatif. Name of work View this entry on the original dictionary page scan.
yogasiddhif. simultaneous accomplishment View this entry on the original dictionary page scan.
yogasiddhimatmfn. experienced in the art of magic View this entry on the original dictionary page scan.
yogasiddhiprakriyāf. Name of work View this entry on the original dictionary page scan.
     Apte Search  
658 results
     
akara अकर a. [न. ब.] 1 Handless, maimed. -2 Exempt from tax or duty. -3 [न. त.] Not doing or acting; not disposed to work, ceasing from work. -रा N. of a plant आमलकी, Emblic Myrobalan, Phyllanthus Emblica (Mar. आंवळा) (अकं दुःखं सेवनात् लोकानां राति गृह्णाति नाश- यतीति; रा-क Tv.).
akṣiyad अक्षियद् a. [न. त.] Ved. Not decreasing in wealth; destitute of a dwelling, unsettled (?); क्षियन्तं त्वमक्षियन्तं कृणोति Rv.4.17.13.
agasti अगस्ति [विन्ध्याख्यं अगं अस्यति; अस्-क्तिच् शकन्ध्वादि˚, Uṇ.4. 179, or अगं विन्ध्याचलं स्त्यायति _x001F_+स्तभ्नाति, स्त्यै-क; or अगः कुम्भः तत्र स्त्यानः संहतः इत्यगस्त्यः] 1 'Pitcher-born,' N. of a celebrated Ṛiṣi or sage. -2 N. of the star Canopus, of which Agastya is the regent. -3 N. of a plant (बकवृक्ष) Sesbana (or Ӕschynomene) Grandiflora [Mar. रुईमंदार]. [The sage Agastya is a very reputed personage in Hindu mythology. In the Ṛigveda he and Vasiṣṭha are said to be the off-springs of Mitra and Varuṇa, whose seed fell from them at the sight of the lovely nymph Urvaśī at a sacrificial session. Part of the seed fell into a jar and part into water; from the former arose Agastya, who is, therefore, called Kumbhayoni, Kumbhajanman, Ghaṭodbhava, Kalaśayoni &c; from the latter Vasiṣṭha. From his parentage Agastya is also called Maitrāvaruṇi, Aurvaśeya, and, as he was very small when he was born, he is also called Mānya. He is represented to have humbled the Vindhya mountains by making them prostrate themselves before him when they tried to rise higher and higher till they wellnigh occupied the sun's disc and obstructed his path. See Vindhya. (This fable is supposed by some, to typify the progress of the Āryas towards the south in their conquest and civilization of India, the humbling of the mountain standing meta-phorically for the removal of physical obstacles in their way). He is also known by the names of Pītābdhi, Samudra-chuluka &c.; from another fable according to which he drank up the ocean because it had offended him and because he wished to help Indra and the gods in their wars with a class of demons called Kāleyas who had hid themselves in the waters and oppressed the three worlds in various ways. His wife was Lopāmudrā. She was also called Kauṣītakī and Varapradā. She bore him two sons, Dṛḍhāsya and Dṛḍhāsyu. In the Rāmāyaṇa Agastya plays a distinguished part. He dwelt in a hermitage on mount Kunjara to the south of the Vindhya and was chief of the hermits of the south. He kept under control the evil spirits who infested the south and a legend relates how he once ate up a Rākṣasa named Vātāpi, who had assumed the form of a ram, and destroyed by a flash of his eye the Rākṣasa's brother who attempted to avenge him. In the course of his wandering Rāma with his wife and brother came to the hermitge of Agastya who received him with the greatest kindness and became his friend, adviser and protector. He gave Rāma the bow of Viṣṇu and accompanied him to Ayodhyā when he was restored to his kingdom after his exile of 14 years. The superhuman power which the sage possessed, is also represented by another legend, according to which he turned king Nahuṣa into a serpent and afterwards restored him to his proper form. In the south he is usually regarded as the first teacher of science and literature to the primitive Dravidian tribes, and his era is placed by Dr. Caldwell in the 7th or 6th century B.C. The Purāṇas represent Agastya as the son of Pulastya (the sage from whom the Rākṣsas sprang) and Havirbhuvā the daughter of Kardama. Several 'hymn-seers' are mentioned in his family, such as his two sons, Indra-bāhu, Mayobhuva and Mahendra, also others who served to perpetuate the family. The sage is represented as a great philosopher, benevolent and kind-hearted, unsurpassed in the science of archery and to have taken a principal part in the colonization of the south; निर्जितासि मया भद्रे शत्रुहस्तादमर्षिणा । अगस्त्येन दुराधर्षा मुनिना दक्षिणेव _x001F_.दिक् ॥ Rām; अगस्त्याचरितामाशाम् R.4.44; cf. also; अगस्त्यो दक्षिणामाशामाश्रित्य नभसिः स्थितः । वरुणस्यात्मजो योगी विन्ध्यवातापिमर्दनः ॥ and R.6.61; Mv.7.14.] अगस्तितुल्या हि घृताब्धिशोषणे । Udbhaṭa.
agūḍha अगूढ a. Not hidden, or concealed, manifest, clear: ˚सद्भावम् Real state unconcealed, अगूढसद्भावमितीङ्गितज्ञया निवोदितो नैष्ठिकसुन्दरस्तया Ku.5.62. -Comp. -गन्ध a. having an unconcealed smell. (-न्धः) Asafœtida (the smell of which is not easily concealed). [Mar. हिंग]. -भाव a.. 1 having an open or unreserved disposition. -2 having an obvious meaning or import.
agniḥ अग्निः [अङ्गति ऊर्ध्वं गच्छति अङ्ग्-नि,नलोपश्च Uṇ.4.5., or fr. अञ्च् 'to go.'] 1 Fire कोप˚, चिन्ता˚, शोक˚, ज्ञान˚, राज˚, &c. -2 The God of fire. -3 Sacrificial fire of three kinds (गार्हपत्य, आहवनीय and दक्षिण); पिता बै गार्हपत्यो$ ग्निर्माताग्निर्दक्षिणः स्मृतः । गुरुराहवनीयस्तु साग्नित्रेता गरीयसी ॥ Ms. 2.232. -4 The fire of the stomach, digestive faculty, gastric fluid. -5 Bile (नाभेरूर्ध्व हृदयादधस्तादामाशयमाचक्षते तद्गतं सौरं तेजः पित्तम् इत्याचक्षते). -6 Cauterization (अग्नि- कर्मन्). -7 Gold. -8 The number three. शराग्निपरिमाणम् (पञ्चत्रिंशत्) Mb.13.17.26. -9 N. of various plants: (a) चित्रक Plumbago Zeylanica; (b) रक्तचित्रक; (c) भल्लातक Semicarpus Anacardium; (d) निम्बक Citrus Acida. -1 A mystical substitute for the letter र्. In Dvandva comp. as first member with names of deities, and with particular words अग्नि is changed to अग्ना, as ˚विष्णू, ˚मरुतौ, or to अग्नी, ˚पर्जन्यौ, ˚ वरुणौ, ˚षोमौ -11 पिङगला नाडी; यत्र तद् ब्रह्म निर्द्वन्द्वं यत्र सोमः, (इडा) सहाग्निना (अग्निः पिङ्गला) Mb.14.2.1. -12 Sacrificial altar, अग्निकुण्ड cf. Rām. 1.14.28. -13 Sky. अग्निर्मूर्धा Muṇḍ 2.1.4. [cf. L. ignis.] [Agni is the God of Fire, the Ignis of the Latins and Ogni of the Slavonians. He is one of the most prominent deities of the Ṛigveda. He, as an immortal, has taken up his abode among mortals as their guest; he is the domestic priest, the successful accomplisher and protector of all ceremonies; he is also the religious leader and preceptor of the gods, a swift messenger employed to announce to the immortals the hymns and to convey to them the oblations of their worshippers, and to bring them down from the sky to the place of sacrifice. He is sometimes regarded as the mouth and the tongue through which both gods and men participate in the sacrifices. He is the lord, protector and leader of people, monarch of men, the lord of the house, friendly to mankind, and like a father, mother, brother &c. He is represented as being produced by the attrition of two pieces of fuel which are regarded as husband and wife. Sometimes he is considered to have been brought down from heaven or generated by Indra between two clouds or stones, created by Dyau, or fashioned by the gods collectively. In some passages he is represented as having a triple existence, which may mean his three-fold manifestations as the sun in heaven, lightning in the atmosphere, and as ordinary fire on the earth, although the three appearances are also elsewhere otherwise explained. His epithets are numberless and for the most part descriptive of his physical characteristics : धूमकेतु, हुतभुज्, शुचि, रोहिताश्व, सप्तजिह्व, तोमरधर, घृतान्न, चित्रभानु, ऊर्ध्वशोचिस्, शोचिष्केश, हरिकेश, हिरण्यदन्त, अयोदंष्ट्र &c. In a celebrated passage he is said to have 4 horns, 3 feet, 2 heads, and 7 hands. The highest divine functions are ascribed to Agni. He is said to have spread out the two worlds and _x001F_+ produced them, to have supported heaven, formed the mundane regions and luminaries of heaven, to have begotten Mitra and caused the sun to ascend the sky. He is the head and summit of the sky, the centre of the earth. Earth, Heaven and all beings obey his commands. He knows and sees all worlds or creatures and witnesses all their actions. The worshippers of Agni prosper, they are wealthy and live long. He is the protector of that man who takes care to bring him fuel. He gives him riches and no one can overcome him who sacrifices to this god. He confers, and is the guardian of, immortality. He is like a water-trough in a desert and all blessing issue from him. He is therefore constantly supplicated for all kinds of boons, riches, food, deliverance from enemies and demons, poverty, reproach, childlessness, hunger &c. Agni is also associated with Indra in different hymns and the two gods are said to be twin brothers. Such is the Vedic conception of Agni; but in the course of mythological personifications he appears as the eldest son of Brahmā and is called Abhimānī [Viṣṇu Purāṇa]. His wife was Svāhā; by her, he had 3 sons -Pāvaka, Pavamāna and Śuchi; and these had forty-five sons; altogether 49 persons who are considered identical with the 49 fires. He is also represented as a son of Aṅgiras, as a king of the Pitṛs or Manes, as a Marut and as a grandson of Śāṇḍila, and also as a star. The Harivaṁśa describes him as clothed in black, having smoke for his standard and head-piece and carrying a flaming javelin. He is borne in a chariot drawn by red horses and the 7 winds are the wheels of his car. He is accompanied by a ram and sometimes he is represented as riding on that animal. Agni was appointed by Brahamā as the sovereign of the quarter between the south and east, whence the direction is still known as Āgneyī. The Mahābhārata represents Agni as having exhausted his vigour and become dull by devouring many oblations at the several sacrifices made by king Śvetaki, but he recruited his strength by devouring the whole Khāṇḍava forest; for the story see the word खाण्डव]. -Comp. -अ (आ) गारम् -रः, -आलयः, -गृहम् [अग्निकार्याय अगारम् शाक˚ त.] a fire-sanctuary, house or place for keeping the sacred fire; वसंश्चतुर्थो$ग्निरिवाग्न्यगारे R.5.25. रथाग्न्यगारं चापार्चीं शरशक्तिगदे- न्धनम् Mb.11.25.14. -अस्त्रम् fire-missile, a rocket, -आत्मक a. [अग्निरात्मा यस्य] of the nature of fire सोमा- त्मिका स्त्री, ˚कः पुमान्. -आधानम् consecrating the fire; so ˚आहिति. -आधेयः [अग्निराधेयो येन] a Brāhmana who maintains the sacred fire. (-यम्) = ˚आधानम्. -आहितः [अग्निराहितो येन, वा परनिपातः P.II.2.37.] one who maintains the sacred fire; See आहिताग्नि. -इध् m. (अग्नीध्रः) [अग्निम् इन्द्धे स अग्नीध्] the priest who kindles fire (mostly Ved). -इन्धनः [अग्निरिध्यते अनेन] N. of a Mantra. (नम्) kindling the fire; अग्नीन्धनं भैक्षचर्याम् Ms.2.18. -उत्पातः [अग्निना दिव्यानलेन कृतः उत्पातः] a fiery portent, meteor, comet &c. In Bṛ. S.33 it is said to be of five kinds: दिवि भुक्तशुभफलानां पततां रूपाणि यानि तान्युल्काः । धिष्ण्योल्का- शनिविद्युत्तारा इति पञ्चधा भिन्नाः ॥ उल्का पक्षेण फलं तद्वत् धिष्ण्याशनिस्त्रिभिः पक्षैः । विद्युदहोभिः ष़ड्भिस्तद्वत्तारा विपाचयति ॥ Different fruits are said to result from the appearances of these portents, according to the nature of their colour, position &c. -उद्धरणम्, -उद्धारः 1 producing fire by the friction of two araṇis. -2 taking out, before sun-rise, the sacred fire from its cover of ashes previous to a sacrifice. -उपस्थानम् worship of Agni; the Mantra or hymn with which Agni is worshipped (अग्निरुपस्थीयते$नेन) अग्निस्त्रिष्टुभ् उपस्थाने विनियोगः Sandhyā. -एधः [अग्निमेधयति] an incendiary. -कणः; -स्तोकः a spark. -कर्मन् n. [अग्नौ कर्म स. त.] 1 cauterization. -2 action of fire. -3 oblation to Agni, worship of Agni (अग्निहोत्र); so ˚कार्य offering oblations to fire, feeding fire with ghee &c.; निर्वर्तिताग्निकार्यः K.16.; ˚र्यार्धदग्ध 39, Ms.3.69, अग्निकार्यं ततः कुर्यात्सन्ध्ययोरुभयोरपि । Y.1.25. -कला a part (or appearance) of fire; ten varieties are mentioned धूम्रार्चिरुष्मा ज्वलिनी ज्वालिनी विस्फु- लिङ्गिनी । सुश्री: सुरूपा कपिला हव्यकव्यवहे अपि ॥ यादीनां दश- वर्णानां कला धर्मप्रदा अमूः ।). -कारिका [अग्निं करोति आधत्ते करणे कर्तृत्वोपचारात् कर्तरि ण्वुल्] 1 the means of consecrating the sacred fire, the Ṛik called अग्नीध्र which begins with अग्निं दूतं पुरो दधे. 2. = अग्निकार्यम्. -काष्ठम् अग्नेः उद्दीपनं काष्ठं शाक ˚त.] agallochum (अगुरु) -कुक्कुटः [अग्नेः कुक्कुट इव रक्तवर्णस्फुलिङ्गत्वात्] a firebrand, lighted wisp of straw. -कुण्डम [अग्नेराधानार्थं कुण्डम्] an enclosed space for keeping the fire, a fire-vessel. -कुमारः, -तनयः; सुतः 1 N. of Kārttikeya said to be born from fire; Rām.7. See कार्त्तिकेय. -2 a kind of preparation of medicinal drugs. -कृतः Cashew-nut; the plant Anacardium occidentale. [Mar.काजू] -केतुः [अग्नेः केतुरिव] 1 smoke. -2 N. of two Rākṣasas on the side of Rāvaṇa and killed by Rāma. -कोणः -दिक् the south-east corner ruled over by Agni; इन्द्रो वह्निः पितृपतिर्नौर्ऋतो वरुणो मरुत् । कुबेर ईशः पतयः पूर्वादीनां दिशां क्रमात् ॥ -क्रिया [अग्निना निर्वर्तिता क्रिया, शाक. त.] 1 obsequies, funeral ceremonies. -2 branding; भेषजाग्निक्रियासु च Y.3.284. -क्रीडा [तृ. त.] fire-works, illuminations. -गर्भ a. [अग्निर्गर्भे यस्य] pregnant with or containing fire, having fire in the interior; ˚र्भां शमीमिव Ś 4.3. (--र्भः) [अग्निरिव जारको गर्भो यस्य] 1 N. of the plant Agnijāra. -2 the sun stone, name of a crystal supposed to contain and give out fire when touched by the rays of the sun; cf Ś2.7. -3 the sacrificial stick अरणि which when churned, gives out fire. (-र्भा) 1 N. of the Śamī plant as containing fire (the story of how Agni was discovered to exist in the interior of the Śamī plant is told in chap. 35 of अनु- शासनपर्व in Mb.) -2 N. of the earth (अग्नेः सकाशात् गर्भो यस्यां सा; when the Ganges threw the semen of Śiva out on the Meru mountain, whatever on earth &c. was irradiated by its lustre, became gold and the earth was thence called वसुमती) -3 N. of the plant महा- ज्योतिष्मती लता (अग्निरिव गर्भो मध्यभागो यस्याः सा) [Mar. माल- कांगोणी] -ग्रन्थः [अग्निप्रतिपादको ग्रन्थः शाक. त.] the work that treats of the worship of Agni &c. -घृतम् [अग्न्युद्दीपनं घृतं शाक. त.] a kind of medicinal preparation of ghee used to stimulate the digestive power. -चित् m. अग्निं चितवान्; चि-भूतार्थे क्विप् P.III.2.91] one who has kept the sacred fire; यतिभिः सार्धमनग्निमग्निचित् R.8.25; अध्वरे- ष्वग्निचित्वत्सु Bk.5.11. -चयः, -चयनम्, -चित्या. arranging or keeping the sacred fire (अग्न्याधान); चित्याग्निचित्ये च P.III.1.132. -2 (-यः, -यनः) the Mantra used in this operation. -3 a heap of fire -चित्वत् [अग्निचयनम् अस्त्यस्मिन् मतुप्; मस्य वः । तान्तत्वान्न पद- त्वम् Tv.] having अग्निचयन or अग्निचित्. -चूडः A bird having a red tuft. -चर्णम् gunpowder. कार्यासमर्थः कत्यस्ति शस्त्रगोलाग्निचूर्णयुक् Śukranīti 2.93. -ज, -जात a. produced by or from fire, born from fire. (-जः, -जातः) 1 N. of the plant अग्निजार (अग्नये अग्न्युद्दीपनाय जायते सेवनात् प्रभवति). 1 N. of Kārttikeya पराभिनत्क्रौञ्चमिवाद्रिमग्निजः Mb.8.9. 68.3. Viṣṇu. (-जम्, -जातम) gold; so ˚जन्मन्. -जित् m. God; Bhāg.8.14.4. -जिह्व a. 1 having a fiery tongue. -2 one having fire for the tongue, epithet of a God or of Visṇu in the boar incarnation. (-ह्वा) 1 a tongue or flame of fire. -2 one of the 7 tongues of Agni (कराली धूमिनी श्वेता लोहिता नीललोहिता । सुवर्णा पद्मरागा च जिह्वा: सप्त विभावसोः -3 N. of a plant लाङ्गली (अग्नेर्जिह्वेव शिखा यस्याः सा); of another plant (जलपिप्पली) or गजपिप्पली (विषलाङ्गला) (Mar. जल-गज पिंपळी) -ज्वाला 1 the flame or glow of fire. -2 [अग्नेर्ज्वालेव शिखा यस्याः सा] N. of a plant with red blossoms, chiefly used by dyers, Grislea Tomentosa (Mar. धायफूल, धायटी). -तप् a. [अग्निना तप्यते; तप्-क्विप्] having the warmth of fire; practising austerities by means of fire. -तपस् a. [अग्निभिः तप्यते] 1 practising very austere penance, standing in the midst of the five fires. -2 glowing, shining or burning like fire (तपतीति तपाः अग्निरिव तपाः) hot as fire -तेजस् a. having the lustre or power of fire. (अग्नेरिव तेजो यस्य). (-स् n.) the lustre of fire. (-स् m.) N. of one of the 7 Ṛiṣis of the 11th Manvantara. -त्रयम् the three fires, See under अग्नि. -द a. [अग्निं दाहार्थं गृहादौ ददाति; दा. -क.] 1 giving or supplying with fire -2 tonic, stomachic, producing appetite, stimulating digestion. -3 incendiary; अग्निदान् भक्तदांश्चैव Ms.9.278; अग्निदानां च ये लोकाः Y.2.74; so ˚दायक, ˚दायिन्. यदग्निदायके पापं यत्पापं गुरुतल्पगे. Rām.2.75.45. -दग्ध a. 1 burnt on the funeral pile; अग्निदग्धाश्च ये जीवा ये$प्यदग्धाः कुले मम Vāyu. P. -2 burnt with fire. -3 burnt at once without having fire put into the mouth, being destitute of issue (?); (pl.) a class of Manes or Pitṛis who, when alive, kept up the household flame and presented oblations to fire. -दमनी [अग्निर्दम्यते$नया; दम्-णिच् करणे ल्युट] a narcotic plant, Solanum Jacquini. [Mar. रिंगणी] -दातृ [अग्निं विधानेन ददाति] one who performs the last (funeral) ceremonies of a man; यश्चाग्निदाता प्रेतस्य पिण्डं दद्यात्स एव हि. -दीपन a. [अग्निं दीपयति] stimulating digestion, stomachic, tonic. -दीप्त a. [तृ. त्त.] glowing, set on fire, blazing (-प्ता) [अग्निर्जठरानलो दीप्तः सेवनात् यस्याः सा] N. of a plant ज्योतिष्मती लता (Mar. मालकांगोणी), which is said to stimulate digestion. -दीप्तिः f. active state of digestion. -दूत a. अग्निर्दूत इव यस्मिन् यस्य वा] having Agni for a messenger, said of the sacrifice or the deity invoked; यमं ह यज्ञो गच्छत्यग्निदूतो अरंकृतः Rv.1.14.13. -दूषितः a. branded. -देवः [अग्नि- रेव देवः] Agni; a worshipper of Agni. -देवा [अग्निर्देवो यस्याः] the third lunar mansion, the Pleiades (कृत्तिका). -द्वारम् the door on the south-east of a building; पूर्व- द्वारमथैशाने चाग्निद्वारं तु दक्षिणे । Māna.9.294-95. -धानम् [अग्निर्धियते$स्मिन्] the place or receptacle for keeping the sacred fire, the house of अग्निहोतृ; पदं कृणुते अग्निधाने Rv. 1.165.3. -धारणम् maintaining the sacred fire; व्रतिनां ˚णम् K. 55. -नयनम् = ˚प्रणयनम्. -निर्यासः [अग्नेर्ज- ठरानलस्येव दीपको निर्यासो यस्य] N. of the plant अग्निजार. -नेत्र a. [अग्निर्नेता यस्य] having Agni for the leader or conveyer of oblations, an epithet of a god in general. -पदम् 1 the word Agni. -2 fire-place. -3 N. of a plant. -परिक्रि-ष्क्रि-या care of the sacred fire, worship of fire, offering oblations; गृहार्थो$ग्निपरिष्क्रिया Ms.2.67. -परिच्छदः the whole sacrificial apparatus; गृह्यं चाग्निपरिच्छदम् Ms.6. 4. -परिधानम् enclosing the sacrificial fire with a kind of screen. -परीक्षा [तृ. त.] ordeal by fire. -पर्वतः [अग्निसाधनं पर्वतः] a volcano; महता ज्वलता नित्यमग्निमेवाग्नि- पर्वतः Rām.5.35.43. -पुच्छः [अग्नेः अग्न्याधानस्थानस्य पुच्छ इव]. tail or back part of the sacrificial place; the extinction of fire. -पुराणम् [अग्निना प्रोक्तं पुराणम्] one of the 18 Purāṇas ascribed to Vyāsa. It derives its name from its having been communicated originally by Agni to the sage Vasiṣṭha for the purpose of instructing him in the two-fold knowledge of Brahman. Its stanzas are said to be 145. Its contents are varied. It has portions on ritual and mystic worship, cosmical descriptions, chapters on the duties of Kings and the art of war, a chapter on law, some chapters on Medicine and some treatises on Rhetoric, Prosody, Grammar, Yoga, Brahmavidyā &c. &c. -प्रणयनम् bringing out the sacrificial fire and consecrating it according to the proper ritual. -प्रणिधिः Incendiary. Dk.2.8. -प्रतिष्ठा consecration of fire, especially the nuptial fire. -प्रवेशः; -शनम [स. त.] entering the fire, self-immolation of a widow on the funeral pile of her husband. -प्रस्कन्दनम् violation of the duties of a sacrificer (अग्निहोमाकरण); ˚परस्त्वं चाप्येवं भविष्यसि Mb.1.84.26. -प्रस्तरः [अग्निं प्रस्तृणाति अग्नेः प्रस्तरो वा] a flint, a stone producing fire. -बाहुः [अग्ने- र्बाहुरिव दीर्घशिखत्वात्] 1 smoke. -2 N. of a son of the first Manu; Hariv. N. of a son of Priyavrata and Kāmyā. V. P. -बीजम् 1 the seed of Agni; (fig.) gold (रुद्रतेजः समुद्भूतं हेमबीजं विभावसोः) -2 N. of the letter र्. -भम [अग्नि- रिव भाति; भा-क.] 1 'shining like fire,' gold. -2 N. of the constellation कृत्तिका. -भु n. [अग्नेर्भवति; भू-क्विप् ह्रस्वान्तः] 1 water. -2 gold. -भू a. [अग्नेर्भवतिः भू-क्विप्] produced from fire. (भूः) 1 'fire-born,' N. of Kārttikeya. -2 N. of a teacher (काश्यप) who was taught by Agni. -3 (arith.) six. -भूति a. produced from fire. (-तिः) [अग्निरिव भूतिरैश्वर्यं यस्य] N. of a pupil of the last Tīrthaṅkara. (-तिः) f. the lustre or might of fire. -भ्राजस् a. Ved. [अग्निरिव भ्राजते; भ्राज्-असुन्] shining like fire. अग्निभ्राजसो विद्युतः Ṛv.5.54.11. -मणिः [अग्नेरुत्थापको मणिः शाक. त.] the sunstone. -मथ् m. [अग्निं मथ्नाति निष्पादयति; मन्थ्-क्विप्- नलोपः] 1 the sacrificer who churns the fuel-stick. -2 the Mantra used in this operation, on the अरणि itself. -मन्थः, -न्थनम्, producing fire by friction; or the Mantra used in this operation. (-न्थः) [अग्निर्मथ्यते अनेन मन्थ्-करणे घञ्] N. of a tree गणिकारिका (Mar. नरवेल) Premna Spinosa (तत्काष्ठयोर्घर्षणे हि आशु वह्निरुत्पद्यते), -मान्द्यम् slowness of digestion, loss of appetite, dyspepsia. -मारुतिः अग्निश्च मरुच्च तयोरपत्यं इञ् ततो वृद्धिः इत् च; द्विपदवृद्धौ पृषो. पूर्वपदस्य ह्रस्वः Tv.] N. of the sage Agastya. -मित्रः N. of a king of the Śunga dynasty, son of Puṣypamitra who must have flourished before 15 B. C. -the usually accepted date of Patañjali-as the latter mentions पुष्यमित्र by name. -मुखः a. having Agni at the head. (-खः) [अग्निर्मुखमिव यस्य] 1 a deity, god, (for the gods receive oblations through Agni who is, therefore, said to be their mouth; अग्निमुखा वै देवाः; अग्निर्मुखं प्रथमं देवतानाम् &c; or अग्निर्मुखे अग्रे येषाम्, for fire is said to have been created before all other gods.) -2 [अग्निर्मुखं प्रधानमुपास्यो यस्य] one who maintains the sacred fire (अग्निहोतृद्विज) -3 a Brāhmaṇa in general (अग्निर्दाहकत्वात् शापाग्निर्मुखे यस्य for Brāhmaṇas are said to be वाग्वज्राः). -4 N. of two plants चित्रक Plumbago Zeylanica and भल्लातक Semicarpus Anacardium अग्निरिव स्पर्शात् दुःखदायकं मुखमग्रम् यस्य, तन्निर्यासस्पर्शेन हि देहे क्षतोत्पत्तेस्थयोस्तथात्वम्) -5 a sort of powder or चूर्ण prescribed as a tonic by चक्रदत्त -6 'fire-mouthed, sharp-biting, an epithet of a bug. Pt. 1. (-खी) अग्निरिव मुखमग्रं यस्याः; गौरादि-ङीष्] 1 N. of a plant भल्लातक (Mar. बिबवा, भिलावा) and लाङ्गलिका (विषलाङ्गला). -2 N. of the Gāyatri Mantra (अग्निरेव मुखं मुखत्वेन कल्पितं यस्याः सा, or अग्नेरिव मुखं प्रजापतिमुखं उत्पत्ति- द्वारं यस्याः, अग्निना समं प्रजापतिमुखजातत्वात्; कदाचिदपि नो विद्वान् गायत्रीमुदके जपेत् । गायत्र्याग्निमुखी यस्मात्तस्मादुत्थाय तां जपेत् ॥ गोभिल). -3 a kitchen [पाकशाला अग्निरिव उत्तप्तं मुखं यस्याः सा]. -मूढ a. [तृ. त.] Ved. made insane or stupefied by lightning or fire. -यन्त्रम् A gun अग्नियन्त्रधरैश्चक्रधरैश्च पुरुषैर्वृतः Śivabhārata 12.17. -यानम् An aeroplane. व्योमयानं विमानं स्यात् अग्नियानं तदेव हि । अगस्त्यसंहिता. -योगः See पञ्चाग्निसाधन. अग्नियोगवहो ग्रीष्मे विधिदृष्टेन कर्मणा । चीर्त्वा द्वादशवर्षाणि राजा भवति पार्थिवः ॥ Mb.13.14,2.43. -योजनम् causing the sacrificial fire to blaze up. -रक्षणम् 1 con-secrating or preserving the sacred (domestic) fire or अग्निहोत्र. -2 [अग्निः रक्ष्यते अनेन अत्र वा] a Mantra securing for Agni protection from evil spirits &c. -3 the house of an अग्निहोतृ. -रजः, -रजस् m. [अग्निरिव रज्यते दीप्यते; रञ्ज्-असुन् नलोपः] 1 a scarlet insect by name इन्द्रगोप. -2 (अग्नेः रजः) the might or power of Agni. -3 gold. Mb.3. 16.86.7 -रहस्यम् mystery of (worshipping &c.) Agni; N. of the tenth book of Śatapatha Brāhmaṇa. -राशिः a heap of fire, burning pile. -रुहा [अग्निरिव रोहति रुह्-क] N. of the plant मांसादनी or मांसरोहिणी (तदङ्कुरस्य वह्नितुल्य- वर्णतया उत्पन्नत्वात्तथात्वं तस्याः). -रूप a. [अग्नेरिव रूपं वर्णो यस्य] fire-shaped; of the nature of fire. -रूपम् the nature of fire. -रेतस् n. the seed of Agni; (hence) gold. -रोहिणी [अग्निरिव रोहति; रुह्-णिनि] a hard inflammatory swelling in the armpit. -लोकः the world a Agni, which is situated below the summit of Meru; in the Purāṇas it is said to be in the अन्तरिक्ष, while in the Kāśī Khaṇḍa it is said to be to the south of इन्द्रपुरी; एतस्या दक्षिणे भागे येयं पूर्दृश्यते शुभा । इमामर्चिष्मतीं पश्य वीतिहोत्रपुरीं शुभाम् ॥ -वधूः Svāhā, the daughter of Dakṣa and wife of Agni -वर्चस् a. [अग्नेर्वर्च इव वर्चो यस्य] glowing or bright like fire. (n.) the lustre of Agni. (-m.) N. of a teacher of the Purāṇas. -वर्ण a. [अग्नेरिव वर्णो यस्य] of the colour of fire; hot; fiery; सुरां पीत्वा द्विजो मोहादग्निवर्णां सुरां पिबेत् Ms.11.9; गोमूत्रमग्निवर्णं वा पिबेदुदकमेव वा 91. (र्णः) 1 N. of a prince, son of Sudarśana. -2 N. of a King of the solar race, See R.19.1. the colour of fire. (-र्णा) a strong liquor. -वर्धक a. stimulating digestion, tonic. (-कः) 1 a tonic. -2 regimen, diet (पथ्याहार). -वल्लभः [अग्नेर्वल्लभः सुखेन दाह्यत्वात्] 1 the Śāla tree, Shorea Robusta. -2 the resinous juice of it. -वासस् a. [अग्निरिव शुद्धं वासो यस्य] having a red (pure like Agni) garment. (n.) a pure garment. -वाह a. [अग्निं वाहयति अनुमापयति वा] 1 smoke. -2 a goat. -वाहनम् a goat (छाग). -विद् m. 1 one who knows the mystery about Agni. -2 an अग्निहोत्रिन् q. v. -विमोचनम् ceremony of lowering the sacrificial fire. -विसर्पः pain from an inflamed tumour, inflammation. -विहरणम्, -विहारः 1 taking the sacrificial fire from आग्नीध्र to the उत्तरवेदि. -2 offering oblations to fire; प्रत्यासन्ना ˚वेला K.348. -वीर्यम् 1 power or might of Agni. -2 gold. -वेतालः Name of Vetāla (connected with the story of Vikra-māditya). -वेशः [अग्नेर्वेश इव] N. of an ancient medical authority (चरक). -वेश्मन् m. the fourteenth day of the karma-ṃāsa; Sūryaprajñapti. -वेश्यः 1 N. of a teacher, Mbh. -2 Name of the 22nd muhūrta; Sūryapraj-ñapti. धौम्य cf. Mb 14.64.8. -शरणम्, -शाला-लम् a fire-sanctuary; ˚मार्गमादेशय Ś.5; a house or place for keeping the sacred fire; ˚रक्षणाय स्थापितो$हम् V.3. -शर्मन् a. [अग्निरिव शृणाति तीव्रकोपत्वात् शॄ-मनिन्] very passionate. (-m.) N. of a sage. -शिख a. [अग्नेरिव अग्निरिव वा शिखा यस्य] fiery, fire-crested; दहतु ˚खैः सायकैः Rām. (-खः) 1 a lamp. -2 a rocket, fiery arrow. -3 an arrow in general. -4 safflower plant. -5 saffron. -6 जाङ्गलीवृक्ष. (-खम्) 1 saffron. -2 gold. (-खा) 1 a flame; शरैरग्निशिखोपमैः Mb. -2 N. of two plants लाङ्गली (Mar. वागचबका or कळलावी) Gloriosa Superba; of other plants (also Mar. कळलावी) Meni-spermum Cordifolium. -शुश्रूषा careful service or worship of fire. -शेखर a. fire-crested. (-रः) N. of the कुसुम्भ, कुङ्कुम and जाङ्गली trees (-रम्) gold, -शौच a. [अग्नेरिव शौचं यस्य] bright as fire; purified by fire K.252. -श्री a. [अग्नेरिव श्रीर्यस्य] glowing like fire; lighted by Agni -ष्टुत्, -ष्टुभ, -ष्टोम &c. see ˚ स्तुत्, ˚स्तुभ् &c. -ष्ठम् 1 kitchen; अग्निष्ठेष्वग्निशालासु Rām.6.1.16. -2 a fire-pan. -संयोगाः explosives. Kau. A.2.3. -ष्वात्तः see स्वात्तः -संस्कारः 1 consecration of fire. -2 hallowing or con-secrating by means of fire; burning on the funeral pile; यथार्हं ˚रं मालवाय दत्वा Dk.169; नास्य कार्यो$ग्निसंस्कारः Ms.5.69, पितरीवाग्निसंस्कारात्परा ववृतिरे क्रियाः । R.12.56. -सखः; -सहायः 1 the wind. -2 the wild pigeon (smoke-coloured). -3 smoke. -सम्भव a. [प. ब.] sprung or produced from fire. (-वः) 1 wild safflower. -2 lymph, result of digestion. (-वम्) gold. -साक्षिक [अग्निः साक्षी यत्र, कप्] a. or adv. keeping fire for a witness, in the presence of fire; पञ्चबाण˚ M.4.12. ˚मर्यादो भर्ता हि शरणं स्त्रियाः H.1.v. l, R.11.48. -सारम् [अग्नौ सारं यस्य अत्यन्तानलोत्तापनेपि सारांशादहनात् Tv.] रसाञ्जन, a sort of medical preparation for the eyes. (-रः -रम्) power or essence of fire. -सुतः Kārttikeya; त्वामद्य निहनिष्यामि क्रौञ्चमग्निसुतो यथा । Mb.7.156.93. -सूत्रम् a thread of fire. -2 a girdle of sacrificial grass (मौञ्जीमेखला) put upon a young Brāhmaṇa at the time of investiture. -सूनुः (See -सुतः), (सेनानीरग्निभूर्गुहः । Amar.); देव्यङ्कसंविष्ट- मिवाग्निसूनुम् । Bu. ch.1.67. -स्तम्भः 1 stopping the burning power of Agni. -2 N. of a Mantra used in this operation. -3 N. of a medicine so used. -स्तुत् m. (अग्निष्टुत्) [अग्निः स्तूयते$त्र; स्तु-आधारे क्विप् षत्वम्] the first day of the Agniṣṭoma sacrifice; N. of a portion of that sacrifice which extends over one day; यजेत वाश्वमेधेन स्वर्जिता गोसवेन वा । अभिजिद्विश्वजिद्भ्यां वा त्रिवृता- ग्निष्टुतापि वा ॥ Ms.11.74. -स्तुभ् (˚ष्टुभ्) m. [अग्निः स्तुभ्यते$त्र; स्तुभ्-क्विप् षत्वम्] 1 = अग्निष्टोम. -2 N. of a son of the sixth Manu. -रतोमः (˚ष्टोमः) [अग्नेः स्तोमः स्तुतिसाधनं यत्र] 1 N. of a protracted ceremony or sacrificeial rite extending over several days in spring and forming an essential part of the ज्योतिष्टोम. -2 a Mantra or Kalpa with reference to this sacrifice; ˚मे भवो मन्त्रः ˚मः; ˚मस्य व्याख्यानम्, कल्पः ˚मः P.IV.3.66. Vārt. -3 N. of the son of the sixth Manu. -4 a species of the Soma plant; ˚सामन् a part of the Sāma Veda chanted at the conclusion of the Agniṣṭoma sacrifice. -सावर्णिः Name of Manu. -स्थ a. (ष्ठ) [अग्नौ स्थातुमर्हति; स्था-क षत्वम्] placed in, over, or near the fire. (ष्ठः) an iron frying-pan; in the अश्वमेध sacrifice the 11th Yūpa which of all the 21 is nearest the fire. -स्वात्तः (written both as ˚स्वात्त and ˚ष्वात्त) (pl.) [अग्नितः i. e. श्राद्धीयविप्रकर- रूपानलात् सुष्ठु आत्तं ग्रहणं येषां ते] N. of a class of Pitṛs or Manes who, when living on earth, maintained the sacred or domestic fires, but who did not perform the Agniṣṭoma and other sacrifices. They are regarded as Manes of Gods and Brāhmaṇas and also as descendants of Marīchi; Ms.3.195. अग्निष्वात्ताः पितर एह गच्छत Tsy.2.5.12.2. (मनुष्यजन्मन्यग्निष्टोमादियागमकृत्वा स्मार्तकर्मनिष्ठाः सन्तो मृत्वा च पितृत्वं गताः इति सायणः). -हुत्, -होतृ Ved. sacrificing to Agni, having Agni for a priest; Rv.1.66.8. -होत्रम् [अग्नये हूयते$त्र, हु-त्र, च. त.] 1 an oblation to Agni (chiefly of milk, oil and sour gruel.). -2 maintenance of the sacred fire and offering oblation to it; (अग्नये होत्रं होमो$स्मिन् कर्मणीति अग्निहोत्रमिति कर्मनाम); or the sacred fire itself; तपोवनाग्निहोत्रधूमलेखासु K.26. होता स्यात् ˚त्रस्य Ms.11.36. ˚त्रमुपासते 42; स्त्रीं दाहयेत् ˚त्रेण Ms.5.167,6.4, दाहयित्वाग्निहोत्रेण स्त्रियं वृत्तवतीम् Y.1.89. The time of throwing oblations into the fire is, as ordained by the sun himself, evening (अग्नये सायं जुहुयात् सूर्याय प्रातर्जुहुयात्). Agnihotra is of two kinds; नित्य of constant obligation (यावज्जीवमग्निहोत्रं जुहोति) and काम्य occasional or optional (उपसद्भिश्चरित्वा मासमेकमग्निहोत्रं जुहोति). (-त्र) a. Ved. 1 destined for, connected with, Agnihotra. -2 sacrificing to Agni. ˚न्यायः The rule according to which the नित्यकर्मन्s (which are to be performed यावज्जीवम्) are performed at their stipulated or scheduled time only, during one's life time. This is discussed and established by जैमिनि and शबर at Ms.6. 2.23-26. in connection with अग्निहोत्र and other कर्मन्s. ˚हवनी (णी) a ladle used in sacrificial libations, or अग्निहोत्रहविर्ग्रहणी ऋक् Tv.; See हविर्ग्रहणी; ˚हुत् offering the अग्निहोत्र; ˚आहुतिः invocation or oblation connected with अग्निहोत्र. -होत्रिन् a. [अग्निहोत्र-मत्वर्थे इनि] 1 one who practises the Agnihotra, or consecrates and maintains the sacred fire. -2 one who has prepared the sacrificial place. -होत्री Sacrificial cow; तामग्निहोत्रीमृषयो जगृहु- र्ब्रह्मवादिनः Bhāg.8.8.2.
aṅkaḥ अङ्कः [अङ्क् कर्तरि करणे वा अच्] 1 The lap (n. also); अङ्काद्ययावङ्कमुदीरिताशीः Ku.7.5. passed from lap to lap. -2 A mark, sign; अलक्तकाङ्कां पदवीं ततान R.7.7; पदङ्क्तिरलक्ताङ्का Rām.; रतिवलयपदाङ्के कण्ठे Ku.2.64. marked with the signs or traces &c.: मद्गोत्राङ्कं गेयम् Me.86, a stain, spot, stigma, brand; इन्दोः किरणेष्विवाङ्कः Ku.1.3; कट्यां कृताङ्को निर्वास्यः Ms.8.281. -3 A numerical figure; a number; the number 9. -4 A side flank; proximity, reach (connected with 1 above); समुत्सुकेवाङ्कमुपैति सिद्धिः Ki.3. 4; प्रेम्णोपकण्ठं मुहुरङ्कभाजो रत्नावलीरम्बुधिराबबन्ध Śi.3.36; सिंहो जम्बुकमङ्कमागतमपि त्यक्त्वा निहन्ति द्विपम् Bh.2.3; Ki. 17.64, See- ˚आगत below. -5 An act of a drama, for its nature &c., See S. D.278. -6 A hook or curved instrument. -7 A species of dramatic composition, one of the ten varieties of रूपक, See S. D.519. -8 An ornament (भूषा). -9 A sham fight, military show (चित्रयुद्ध). -1 A coefficient. -11 A place; नानाङ्क- चिह्नैर्नवहेमभाण्डैः (तुरङ्गैः) Bu.ch.2.4. -12 A sin, misdeed. -13 A line, curved line; a curve or bend generally, the bend in the arm. -14 The body. -15 A mountain. अङ्कः स्थानान्तिकक्रोडभूषणोत्संगलक्ष्मसु । मन्तो नाटकविच्छेदे चित्रयुद्धे च रूपके ॥ Nm. [cf. L. uncus; Gr. ogkos] -Comp. -अङ्कमू [अङ्के मध्ये अङ्काः शतपत्रादिचिह्नानि यस्य Tv.] water. -अवतारः when an act, hinted by persons at the end of the preceding act, is brought in continuity with the latter, it is called अङ्कावतार (descent of an act), as the sixth act of Śākuntala or second of Mālavikāgnimitra (अङ्कान्ते सूचितः पात्रैस्तदङ्क- स्याविभागतः । यत्राङकोवतरत्येषो$ङ्कावतार इति स्मृतः S. D.311). The Daśarūpa defines it differently; अङ्कावतारस्त्वङ्कान्ते पातो$ङ्कस्याविभागतः । एभिः संसूचयेत्सूच्यं दृश्यमङ्कैः प्रदर्शयेत् 3.56. -आगत, -गत a. [द्वि. त.] come within the grasp; सिंहत्वं ˚सत्त्ववृत्तिः R.2.18; श्रियं युवाप्यङ्कगतामभोक्ता R.13.67. -करणम् marking, branding &c. -तन्त्रम् the science of numbers (arithmetical or algebraical). -धारणम्-णा 1 bearing or having marks, such as those on the body of a Vaiṣṇava. -2 manner of holding the person. -परिवर्तः [स. त] 1 turning on the other side. -2 rolling or dallying in the lap or on the person; अपि कर्णजाहविनिवेशिताननः प्रियया तदङ्कपरिवर्तमाप्नुयाम् Māl.5.8. (an occasion for) embrace (अङ्के क्रोडे सर्वतो- भावेन वर्तनं हृदयालिङ्गनम् इत्यर्थः -Jagaddhara); so ˚परिवर्तिन्; भर्तुः ˚नी भव M.3. -पादव्रतम् N. of a Vrata; title of a chapter in the भविष्योत्तरपुराण. -पालिः -ली [पा-अलि ष. त. वा. ङीप्] 1 the extremity of region of the lap (क्रोडप्रान्त or प्रदेश); a seat in the lap; hence, an embrace; तावद्गाढं वितर सकृदप्यङ्कपालीं प्रसीद Māl.8.2. स्पृश हस्तेन मे हस्तमेहि देह्यङ्कपालिकाम् । Śivabhārata 21.33. -2 [अङ्केन पालयति पाल्-इ. तृ. त.] a nurse. -3 (-ली) a variety of plant, Piring or Medicago Esculenta; (Mar. धोत्रा-निघण्टुरत्नाकर) [वेदिकाख्यगन्धद्रव्यम्] -पाशः [अङ्कः पाश इव बन्धनेनेव पातनहेतुर्यत्र Tv.] an operation in arithmetic by which a peculiar concatenation or chain of numbers is formed by making the figures 1, 2 &c. exchange places (स्थानान्तमेकादिचयाङ्कघातः संख्याविभेदा नियतैः स्युरङ्कैः । भक्तो$ङ्कमित्याङ्कसमासनिघ्नः स्थानेषु युक्तो मितिसंयुतिः स्यात् ॥ See Līlā.24); (न गुणो न हरो न कृतिर्न घनः पृष्टस्तथापि दुष्टानाम् । गर्वितगणकबहूनां स्यात् पातो$वश्यमङ्कपाशे$स्मिन्). -पूरणम् multiplication of number of figures. -बन्धः. forming the lap, bending the thighs into a curve and squatting down. -2 branding with a mark that resembles a headless trunk (अशिरःपुरुषाकरो$ङ्कः). --भाज् [अङ्कं भजते उप. स.] 1 seated in the lap or carried on the hip, as an infant. -2 being within easy reach, drawing near, soon to be obtained; अविरहितमनेकेनाङ्कभाजा फलेन Ki. 5. 52. -3 premature, early ripe, forced fruit. -मुखम् (or आस्यम्) that part of an act, wherein the subject of all the acts is intimated, is called अङ्कमुख, which suggests the germ as well as the end; e. g. in Māl.1 कामन्दकी and अवलोकिता hint the parts to be played by भूरिवसु and others and give the arrangement of the plot in brief (यत्र स्यादङ्क एकस्मिन्नङ्कानां सूचनाखिला । तदङ्क- मुखमित्याहुर्बीजार्थख्यापकं च तत् ॥ S. D.322.) The Daśarūpa defines it thus: अङ्कान्तपौत्ररङ्कास्यं छिन्नाङ्कस्यार्थसूचनात् । i. e. where a character at the end of an act cuts short the story and introduces the beginning of another act; as in the second of Mv. -लोड्यः [अङ्केन लोड्यते असौ] a kind of tree (Mar. चिंचोट), ginger. -लोपः subtraction of numbers. -विद्या the science of numbers, arithmetic.
aṅgāraḥ अङ्गारः रम् [अङ्ग्-आरन् Uṇ.3.134.] 1 Charcoal (whether heated or not); घृतकुम्भसमा नारी तप्ताङ्गारसमः पुमान्; उष्णो दहति चाङ्गारः शीतः कृष्णायते करम् H.1.8; नालास्त्रार्थाग्निचूर्णे तु गन्धाङ्गारौ तु पूर्ववत् Śukra.4.135. त्वया स्वहस्तेनाङ्गाराः कर्षिताः Pt.1 you have ruined yourself with your own hands; cf. "to dig a mine under one's feet." कुरुकुलाङ्गार Ve.6 destroyer or pest of the Kuru family. -2 The planet Mars. -3 A plant हितावली, ˚कुष्टकः- हितावली. -4 N. of a prince who fought with king Māndhātr. -र a. Red, of a red colour. -रम् Red colour. -Comp. -अवक्षेपणम् [अङ्गारा अवक्षिप्यन्ते अनेन करणे ल्युट्] also -अवक्षायणम् (Śat. Br.xiv) a vessel or pincers (Mar. चिमटा) to throw or extinguish coals -कर्करिः (री) f. A thick cake baked on burning coals -कारिन् a. [अङ्गारं करोति कृ-णिनि] one who prepares coal for sale, Mb.2; मालाकार इव ग्राह्यो भागो नाङ्गारकारवत् Śukra.4.223. -कुष्ठकः [अङ्गारवर्णं कुष्ठमिव-कन्] N. of a plant हितावली. -धानी [अङ्गारा धीयन्ते अस्याम्; धा- आधारे ल्युट् ङीप्], -धानिका also -धारिका [स्वार्थे कन्] a portable fire-pan, brazier. -परिपाचितम् [तृ. त.] roasted food or meat. -पर्णम् [अङ्गारमिव पर्णं यस्य] N. of a grove or forest. (-र्णः) [अस्त्यर्थे अच्] N. of Chitraratha, king of the Gandharvas. [On one occasion, while he was sporting with his wife, he saw Kuntī with her five sons proceeding to the capital of Pāñchāla in disguise. He accosted them and asked them to tell him where they were going, or to fight. Arjuna accepted the challenge; but Aṅgāraparṇa finding Arjuna to be a very skilful warrior gave him a secret lore called Chākṣuṣī (enabling one to see the smallest things) and took from him in return a lore called Agniśirāstra and became a friend of the Pāṇḍavas.] -पात्री -शकटी a portable fire-pan. -पुष्पः [अङ्गारमिव लोहितवर्णं पुष्पं यस्य सः] the plant इङ्गुदी. -पूरिका (see अङ्गारकर्करिः) -म़ञ्जरी, -मञ्जी [अङ्गारा रक्तवर्णा मञ़्जरी यस्याः] a shrub Cesalpinia Banducella (रक्तकरंजवृक्ष). -वल्लरी, -वल्ली [अङ्गारा इव रक्तफलत्वात् रक्ता] N. of various plants, करंज, भार्गी, गुञ़्जा. also Guilandina Bonducella (Mar. सागरगोटी). -वृक्षः Balanites Aegiptiaca (Mar. हिंगणबेट). -वेणुः [कर्म.] a sort of bamboo. -सदनम् A portable fire-pan.
aṅgiraḥ अङ्गिरः अङ्गिरस् m. [अङ्गति-अङ्ग् गतौ असि इरुट्; Uṇ 4. 235; according to Ait. Br. अङ्गिरस् is from अङ्गार; ये अङ्गारा आसंस्ते$ङ्गिरसो$भवन्; so Nir.; अङ्गारेषु यो बभूव सो$ङ्गिराः] N. of a celebrated sage to whom many hymns of the Rigveda (ix) are ascribed. Etymologically Aṅgira is connected with the word Agni and is often regarded as its synonym (शिवो भव प्रजाभ्यो मानुषीभ्यस्त्व- मङ्गिरः; अङ्गिरोभिः ऋषिभिः संपादितत्वात् अङ्गसौष्ठवाद्वा अङ्गिरा अग्निरूपः) According to Bhārata he was son of Agni. When Agni began to practise penance, Aṅgiras himself became Agni and surpassed him in power and lustre, seeing which Agni came to the sage and said:- निक्षिपाम्यहमग्नित्वं त्वमग्निः प्रथमो भव । भविष्यामि द्वितीयो$हं प्राजा- पत्यक एव च ॥ Aṅgiras said :- कुरु पुण्यं प्रजासर्गं भवाग्निस्तिमि- रापहः । मां च देव कुरुष्वाग्ने प्रथमं पुत्रमञ्जसा ॥ तत्श्रुत्वाङ्गिरसो वाक्यं जातवेदास्तथा$करोत्. He was one of the 1 mind-born sons of Brahmā. His wife was Śraddhā, daughter of Kardama and bore him three sons, Bṛhaspati, Utathya and Saṁvarta, and 4 daughters Kuhū, Sinīvālī, Rākā and Anumati. The Matsya Purāṇa says that Aṅgiras was one of the three sages produced from the sacrifice of Varuṇa and that he was adopted by Agni as his son and acted for some time as his regent. Another account, however, makes him father of Agni. He was one of the seven great sages and also one of the 1 Prajāpatis or progenitors of mankind. In latter times Aṅgiras was one of the inspired lawgivers, and also a writer on Astronomy. As an astronomical personification he is Bṛhaspati, regent of Jupiter or Jupiter itself. शिष्यैरुपेता आजग्मु: कश्यपाङ्गिरसादयः (Bhāg. 1.9.8.) He is also regarded as the priest of the gods and the lord of sacrifices. Besides Śraddhā his wives were Smṛti, two daughters of Maitreya, some daughters of Dakṣa, Svadhā and Satī. He is also regarded as teacher of Brahmavidyā. The Vedic hymns are also said to be his daughters. According to the Bhāgavata Purāṇa, Aṅgiras begot sons possessing Brahmanical glory on the wife of Rāthītara, a Kṣatriya who was childless and these persons were afterwards called descendants of Aṅgiras. The principal authors of vedic hymns in the family of Aṅgi-ras were 33. His family has three distinct branches केवलाङ्गिरस, गौतमाङ्गिरस and भारद्वाजाङ्गिरस each branch having a number of subdivisions. - (pl.) 1 Descendants of Aṅgiras, [Aṅgiras being father of Agni they are considered as descendants of Agni himself who is called the first of the Aṅgirasas. Like Aṅgiras they occur in hymns addressed to luminous objects, and at a later period they became for the most part personifications of light, of luminous bodies, of divisions of time, celestial phenomena and fires adapted to peculiar occasions, as the full moon and change of the moon, or to particular rites, as the अश्वमेध, राजसूय &c.] -2 Hymns of the Atharvaveda. -3 Priests, who, by using magical formulas of the Atharvaveda, protect the sacrifice against the effects of inauspicious accidents.
aja अज a. [न जायते; जन्-ड. न. त.] Unborn, existing from all eternity; यो मामजमनादिं च वेत्ति लोकमहेश्वरम् Bg.1. 3; अजस्य गृह्णतो जन्म R.1.24. -जः 1 The 'unborn', epithet of the Almighty Being; न हि जातो न जाये$हं न जनिष्ये कदाचन । क्षेत्रज्ञः सर्वभूतानां तस्मादहमजः स्मृतः ॥ Mb.; also a N. of Viṣṇu, Śiva or Brahmā. -2 The (individual) soul (जीवः) अजो नित्यः शाश्वतो$यं पुराणो न हन्यते हन्यमाने शरीरे Bg.2.2. -3 A ram, he-goat (अजेन ब्रह्मणा दक्षयज्ञभङ्गसमये मेषरूपग्रहणेन पलायमानत्वात् अजाधिष्ठितरूपवत्त्वात् मेषस्य उपचारात् अजत्वम् Tv.] -4 The sign Aries. -5 A sort of corn or grain; अजैर्यष्टव्यं तत्राजा व्रीहयः Pt.3. -6 Mover, leader (Ved.), said of Indra, Maruts, &c.; a drove. -7 N. of a mineral substance (माक्षिकधातु). -8 N. of the Moon or Kāmadeva (आत् विष्णोर्जायते इति; cf. चन्द्रमा मनसो जातः). -9 A vehicle of the sun. -1 N. of the father of Daśaratha and grand-father of Rāma; so called because he was born on the Brāhma Muhūrta. -11 N. of a Ṛiṣi. cf. अजो हरौ हरे कामे विधौ छागे रघोः सुते । Nm. -Comp. -अदः [अजम् अत्तीति; अद्-कर्मण्यण् P.III.2.9.] N. of the ancestor of a warrior tribe, P.IV.1.171. -अदनी [अजैः तृप्त्या अन्यैः दुःखस्पर्शत्वे$पि अद्यते; अद् कर्मणि ल्युट्] a kind of prickly nightshade, दुरालभा (Mar. धमासा). -अन्त्री [अजस्य अन्त्रमिव अन्त्रं तदाकारवती मञ्जरी यस्याः] N. of a pot-herb Convolvulus Argenteus, नीलबुह्ना. (Mar. शंखवेल ?) -अविकम् [अजाश्चावयश्च तेषां समाहारः द्वन्द्व] goats and sheep; small cattle; अजाविके तु संरुद्धे Ms.8.235. खरोष्ट्र- महिषीश्चैव यच्च किञ्चिदजाविकम् Mb.1.113.35. -अश्वम् goats and horses. (-श्वः) the Sun or Pūṣan, who has goats for the horses. -एकपाद्-दः [अजस्य छागस्य एकः पाद इव पादो यस्य] N. of one of the 11 Rudras, or of the asterism पूर्वाभाद्रपदा presided over by that deity. -एडकम् [अजाश्च एडकाश्च तेषां समाहारः] goats and rams. -कर्णः -कर्णकः [अजस्य कर्णं इव पर्णं यस्य-स्वार्थे कन्] N. of the plant असनवृक्ष Terminalia Alata Tomentosa; of another tree साल Shorea Robusta. -गन्धा [अजस्य गन्ध इव गन्धो यस्याः सा] the shrubby basil, वनयामानी. -गन्धिका a kind of वर्वरीशाक (Mar. तिलवणी, कानफोडी). -गन्धिनी = अजशृङ्गी q. v. -गरः [अजं छागं गिरति भक्षयति; गॄ-अच्] a huge serpent (boa-constrictor) who is said to swallow goats. (-री) N. of a plant. -गल See अजागल below. -गल्लिका [अजस्य गल्ल इव] an infantile disease (Mentagra). -जीवः, -जीविकः [अजैस्तच्चारणेन जीवति; अजा एव जीविका यस्य वा] a goat-herd; so -˚पः, -˚पालः. -दण्डी [अजस्य ब्रह्मणो दण्डो यस्याः सा] ब्रह्मदण्डी a kind of plant (ब्रह्मणो यज्ञार्थदण्डस्य तदीयकाष्ठेन करणात् तथात्वम्). -देवता 1 N. of the 25th asterism. पूर्वाभाद्रपदा. -2 fire, the presiding deity of goats (रौद्री धेनुर्विनिर्दिष्टा छाग आग्नेय उच्यते). -नामकः [अजः नाम यस्य सः कप्] a mineral substance. -नाशनः A wolf. -पतिः 1 the best of goats. -2 N. of Mars; lord of the sign Aries. -पथः = अजवीथिः q. v. -पदः, -पाद्-दः N. of a Rudra; See अजैकपाद above. -बन्धुः [अजस्य बन्धुरिव मूर्खत्वात्] a fool (silly like the goat). -भक्षः [अजैर्भक्ष्यते असौ भक्ष्-कर्मणि घञ्] N. of the वर्वरी plant (तिळवण the leaves of which are very dear to goats). -मायु a. Ved. bleating like a goat (a frog) गोमायुरेक अजमायुरेकः Rv.7. 13.6,1. -मारः [अजं मारयति विक्रयार्थं; मृ-णिच्-अण्] 1 a butcher. -2 N. of a country (the modern Ajmeer, which, it is supposed, formerly abounded in butchers). -3 N. of a tribe (गण). -मीढः [अजो मीढो यज्ञे सिक्तो यत्र ब.] 1 N. of the place called Ajmeer. -2 N. of the eldest son of Hasti, born in the family of Puru, son of Yayāti. -3 N. of a son of सुहोत्र and author of some Vedic hyms like Rv.4.43. -4 surname of Yudhisṭhira. -मुख a. goat-faced. (खः) N. of a Prajāpati (Dakṣa). When Dakṣa reviled Śiva at his sacrificial session, Vīrabhadra pulled out his face, and afterwards at the request of Śiva himself he put up a goat's face in place of the original human one. (-खी) N. of a Rākṣasī kept to watch over Sītā in the Aśoka garden at Laṅkā. -मोदा, -मोदिका [अजस्य मोद इव मोदो गन्धो यस्याः, अजं मोदयतीति वा] N. of a very useful medicinal plant, Common Carroway; the species called Apium Involucratum or Ligusticum Ajowan (Mar. ओंवा). अजमोदां च बाह्लीकं जीरकं लोध्रकं तथा । _x001F_+Śiva. B.3.18 -लम्बनम् [अज इव लम्ब्यते गृह्यते कृष्णवर्णत्वात् कर्मणि ल्युट्] antimony. (Mar. सुरमा). -लोमन्, -लोमी -मा [अजस्य लोमेव लोममञ्जरी यस्य-स्याः वा] cowage, Carpopogon Pruriens (Mar. कुहिली). -वस्तिः [अजस्य वस्तिरिव वस्ति- र्यस्य] N. of a sage, or of a tribe sprung from him. -वीथिः -थी f. [अजेन ब्रह्मणा निर्मिता वीथिः शाक त.] 1 one of the three divisions of the southern path comprehending the three asterisms मूल, पूर्वाषाढा and उत्तराषाढा; a sort of heavenly passage (गगनसेतु, यमनाला); पितृयानो$- जवीथ्याश्च यदगस्त्यस्य चान्तरम् Y.3.184. -2 goat's path. -शृङ्गी [अजस्य मेषस्य शृङ्गमिव फलं यस्याः सा] N. of a plant, विषाणी or Odina Wodier, highly medicinal, (Mar. मेंढशिंगी), See मेषशृङ्गी.
ajasra अजस्र a. [न जस्-र P.III.2.167; जसिर्नञ्पूर्व: क्रिया- सातत्ये वर्तते Sk.] Not ceasing, constant, perpetual; ˚दीक्षाप्रयतस्य R.3.44. -स्रम् ind. Ever, constantly, perpetually; वृथैव संकल्पशतैरजस्रम् Ś.3.5. तच्च धूनोत्यजस्रम् U.4.26. अजस्रमास्फालित... । Śi.1.9.
atantra अतन्त्र a. [न. ब.] 1 Having no ropes or musical strings (as a musical instrument); नातन्त्री वाद्यते वीणा Rām. -2 Unrestrained; not necessarily binding; not being the object of the rule under consideration; ह्रस्वग्रहणमतन्त्रम्, क्लीबत्वं ˚न्त्रम् Sk. Something which is not intended; on which there is no emphasis or stress (वार्त्तिक 2.2.34.1). -3 Without formulas or empirical actions. -4 Not (having the binding force of) a scientific statement; तत्राविज्ञातग्रहणमतन्त्रमिति कल्प्येत । ŚB. on MS.6.1.7. -त्वम् meaninglessness, superfluity, superfluous nature. किं तु इतरस्मिन् पक्षे बाध्यतेतरां श्रुतिः । ऐन्द्रशब्दस्यातन्त्रत्वात् । ŚB. on MS.6.4.29. अतन्द्र atandra न्द्रित ndrita न् n ल l अतन्द्र न्द्रित न् ल a. Alert, unwearied, careful, vigilant; अतन्द्रिता सा स्वयमेव वृक्षकान् Ku.5.14, R.17.39, H. Pr.33.
atikram अतिक्रम् 1 U., 4 P. 1 (a) To step or pass beyond, get accross, go over, cross यत्कथयितुं प्रवृत्तस्तत्परित्यज्य अतिदूरमतिक्रान्तो$स्मि K.346 led far away from my story, rambled, made a great digression; सप्त कक्षान्तराण्यति- क्रम्य 92; निमिषमात्रेणातिदूरमतिक्रामति 12; समीपे$प्यक्रामन्ती M.1. going so near; अतिक्रम्य तांस्तान् विशेषान् Me.57. (b) To pass over, pass by, walk past, go beyond; सेनानिवेशदेशमतिक्रम्य Dk.4.1; कथमतिक्रान्तमगस्त्याश्रमपदम् Mv.7. is it passed or left behind; तस्मिन्नतिक्रामति Ś.7. 31. इदं कदलीगृहमतिक्रम्य दृश्यते Ratn.3. beyond the plantain-bower; तच्चातिक्रम्य कैलासगिरिः K.121; जम्बुद्वीपमति- क्रम्य शिशिरो नाम पर्वतः Rām; अतिक्रामत्ययम् K.85. is going or departing. -2 To excel, surpass; exceed (in number, strength &c.); इरावतीमतिक्रामन्ती भव M. 4. अतिक्रामन्तीमिवेरावतीं प्रेक्षे M.1; वृद्धिर्नातिक्रामति पञ्चताम् Ms.8.151; कर्णीसुतमप्यतिक्रान्तः Dk.74; कलासु रूपे चाप्सरसो$प्यतिक्रान्ता 78; surpassing, superior to; शक्तिमनति- क्रम्य यथाशक्ति Sk. -3 To transgress, violate, go beyond, overstep; जनकाग्रजन्मनोः शासनमतिक्रम्य Dk.2; नालं पुरुषो नियतिलिखितां लेखामतिक्रमितुम् 61; एवमतिक्रान्तमर्यादे त्वयि Ve.1, अये वात्सल्यादतिक्रामति प्रसङ्गः Māl.6. Oh, the event through excessive affection transgresses all due limits; अतिक्रम्य सदाचारम् K.16,181. -4 To exclude, pass by, neglect, set aside, leave; अतिक्रामेत्प्रमत्तं या मत्तं रोगार्तमेव वा Ms.9.78. किं वा परिजनमतिक्रम्य भावन् संदिष्टः M.4. प्रथितयशसां प्रबन्धानतिक्रम्य M.1. to the exclusion of. -5 To go or pass away, elapse, roll on (as time); सा निशा अतिचक्राम Pt.1; यथा यथा यौवनमतिचक्राम K.59; शैशबम् 74; भवतामप्यतिक्रामति देवार्चनविधिवेला 47; is passing away (is being violated); अतिक्रान्ते दशाहे Ms. 5.76; also trans. allow to pass; द्वित्राणि दिनान्यतिक्रम्य Dk. 1; अत्यक्राममिमान्मासांस्तद्वधं परिचिन्तयन् Rām.; नाहार- वेलातिक्रमणीया K.266. -6 To overcome, overpower, seize; व्यालद्विप इवास्माभिरतिक्रम्यैव दम्यसे Mv.3.31. by seizing or falling upon, by main force; केनापि सत्त्वेन अतिक्रम्य Ś.6. -7 To lose; स हि स्वाम्यादतिक्रामेत् ऋतूनां प्रतिरोधनात् Ms.9.93. -Caus. To let pass, allow to go.
ativardhanam अतिवर्धनम् Excessive growth, increase, adding to, increasing; एतत्खलु व्यजनानिलैरति (भि) वर्धनं प्रभञ्जनस्य यदस्म- द्विधैः परिबोधनमार्यस्य K.289; cf. "Carrying coals to New Castle", or "To gild refined gold, to paint the lily, ...or with taper-light the eye of Heaven to garnish is wasteful and ridiculous excess".
atharvan अथर्वन् m. [अथ-ऋ-वनिप् शकन्ध्वादि˚ Tv.; probably connected with some word like athar fire] 1 A priest who has to worship fire and Soma. -2 A Brāhmaṇa. -3 N. of the priest who is said to have first brought down fire from the heaven, offered Soma and recited prayers. [He is represented as the eldest son of Brahmā sprung from his mouth; as a Prajāpati appointed by Brahmā to create and protect sub-ordinate beings, who first learnt from Brahmā and then taught the Brahmavidyā and is considered to be the author of the Veda called after him. His wife was Śānti, daughter of Kardama Prajāpati. He had also another wife called Chitti; he is also considered identical with Aṅgiras and father of Agni.] -4 Epithet of Śiva, Vasiṣṭha. वृतपदपङ्क्तिरथर्वणेव वेदः Kir. 1.1. -(pl.) Descendants of Atharvan; hymns of this Veda; जिष्णुं जैत्रैरथर्वभिः R.17.13. -र्वा-र्व m. n., ˚वेदः The Atharvaveda, regarded as the fourth Veda. [It contains many forms of imprecations for the destruction of enemies and also contains a great number of prayers for safety and averting mishaps, evils, sins or calamities, and a number of hymns, as in the other Vedas, addressed to the gods with prayers to be used at religious and solemn rites; cf. Mv.2.24. मूर्तिमभिरामघोरां बिभ्रदिवाथर्वणो निगमः. It has nine Śākhās and five Kalpas, and is comprised in 2 Kāṇḍas. The most important Brāhmaṇa belonging to this Veda is the Gopatha Brāhmaṇa, and the Upaniṣads pertaining to it are stated to be 52, or, according to another account 31.] [cf. Zend atharvan, Pers. áturbán.] -Comp. -अधिपः N. of बुध Mercury (सामवेदाधिपो भौमः शशिजो$- थर्ववेदराट्). -निधिः, -विढ् m. receptacle of the (knowledge of) Atharvaveda, or conversant with it; गुरुणा- $थर्वविदा कृतक्रियः R.8.4.1.59; (अथर्वविधिपदेन दुरितोपशमन- निमित्तशान्तिकपौष्टिकप्रवीणत्वं पौरोहित्यो चितत्वं द्योत्यते Malli.) -भूताः (pl.) those who have become Atharvans, Names of the 12 Maharṣis. -शिखा, -शिरस् n. (अथर्वणो वेदस्य शिखा शिर इव वा ब्रह्मविद्याप्रतिपादकत्वेन श्रेष्ठत्वात्) N. of an Upaniṣad dealing with Brahmavidyā. अथर्वशिरसो$ध्येता ब्रह्मचारी यतव्रतः Mb.13.9.29. -संहिता A text of collection of hymns of अथर्ववेद. अथर्वसंहितायाजी विदधे विधिवद्धुतम् Bm.1.869.
adūra अदूर a. Not distant, near (in time or space); ˚वर्तिनीं सिद्धिं राजन् विगणयात्मनः R.1.87; ˚उज्झितवर्त्मसु मृगद्वन्द्वेषु 1.4; ˚त्रिंशाः Sk. not far from 3, i. e. nearly 3; ˚कोपा हि मुनिजनप्रकृतिः K.142 easily provoked, irascible. -रम् Proximity, vicinity; वसन्नदूरे किल चन्द्रमौलेः R.6.34; त्रिंशतो$दूरे वर्तन्ते इति अदूरात्रिंशाः Sk.; अदूरे, -रम्, -रेण, -रतः, -रात् (with gen. or abl.) not far from, at no great distance from; अदूरे प्रियासमागमं ते प्रेक्षे V.3 not far distant, very near. -Comp. -भव a. not being far off, _x001F_+being near. (P.IV.2.7).
adeśya अदेश्य a. [न. त. न देष्टुं योग्यः] 1 Not fit to be ordered, advised, indicated or pointed out; अदेश्यं यश्च दीशति Ms. 8.53. -2 Not on the spot or pertaining to the place or occasion referred to.
adhikaraṇam अधिकरणम् [कृ-ल्युदट्] 1 Placing at the head of, appointing &c. -2 Relation, reference, connection; रामाधिकरणाः कथाः Rām. referring to. -3 (In gram.) Agreement, concord, government or grammatical relation (as of subject and predicate &c.); तत्पुरुषः समानाधिकरणः कर्मधारयः P.1.2.42 having the members (of the compound) in the same relation or apposition; समानाधिकरणो or व्यधिकरणो बहुर्व्रीहिः; पीताम्बरः, चक्रपाणिः &c. -4 A receptacle or subject, technically substratum ज्ञानाधिकरणम् आत्मा T. S. the soul is the substratum of knowledge. -5 Location, place, the sense of the locative case; आधारोधिकरणम् P.1.4.45; कर्तृकर्म- व्यवहितामसाक्षाद्धारयत् क्रियाम् । उपकुर्वत् क्रियासिद्धौ शास्त्रेधिकरणं स्मृतम् ॥ Hari; as गेहे स्थाल्यामन्नं पचति. -6 A topic, subject; section, article or paragraph; a complete argument treating of one subject; A chapter in Kauṭilīya Arthaśāstra. e. g. प्रथमाधिकरणम् the Sūtras of Vyāsa and Jaimini are divided into Adhyāyas, the Adhyāyas into Pādas and the Pādas into Adhikara-ṇas or sections. (According to the Mīmāṁsakas a complete Adhikaraṇa consists of five members : विषय the subject or matter to be explained, विशय or संशय the doubt or question arising upon that matter, पूर्वपक्ष the first side or prima facie argument concerning it, उत्तर or उत्तरपक्ष or सिद्धान्त the answer or demonstrated conclusion, and संगति pertinency or relevancy, or (according to others निर्णय the final conclusion); विषयो विशयश्चैव पूर्वपक्षस्तथोत्तरम् । निर्णयश्चैति सिद्धान्तः शास्त्रे$धिकरणं स्मृतम् ॥ The Vedāntins put संगति in th 3 rd place, and सिद्धान्त last; तत्र एकैकमधिकरणं पञ्चावयवम्, विषयः संदेहः संगतिः पूर्वपक्षः सिद्धान्तश्च. Generally speaking, the five members may be विषय, संशय, पूर्वपक्ष, उत्तरपक्ष and सिद्धान्त or राद्धान्त). -7 Court of justice, court, tribunal; स्वान्दोषान् कथयन्ति नाधिकरणे Mk.9.3; ˚रणे च साधनम् Dk.4. -8 Stuff, material; विप्रतिषिद्धं चानधिकरणवाचि P.II.4.13 (अद्रव्यवाचि); अधिकरणै ˚एतावत्त्वे च P.II.4.15 fixed number of things, as दश तन्तोष्ठः Sk. -9 A claim, Bhāg, 5.1.16. -1 Supremacy. -11 A government department; सर्वाधिकरणरक्षणम् Kau. A.4. -12 A gathering place प्रत्यक्षाश्च परोक्षाश्च सर्वाधिकरणेष्वथ । वृत्तेर्भरतशार्दूल नित्यं चैवान्ववेक्षणम् ॥ Mb.12.59.68. -13 A department; अश्वागारान् गजागारान् बलाधिकरणानि च Mb.12. 69.54. -णी One who superintends. -Comp. -भोजकः a court-dignitary, a judge, भीतभीता अधिकरणभोजकाः Mk.9. -मण्डपः court or hall of justice. अधिकरणमण्डपस्य मार्गमादेशय Mk.9. -लेखकः a. official recorder or scribe, who drew up sale-deeds and other documents after getting the land measured in his presence; RT.VI.38. -विचालः [अधिकरणस्य विचालः अन्यथाकरणम्] changing the quantity of any thing, increasing or decreasing it so many times; ˚विचाले च P.V.3.43; द्रव्यस्य संख्यान्तरापादने संख्याया धा स्यात्; एकं राशिं पञ्चधा कुरु Sk. -सिद्धान्तः a conclusion which involves others.
adhikāraḥ अधिकारः 1 Superintendence, watching over; स्त्रीषु कष्टो$धिकारः V.3.1; यः पौरवेण राज्ञा धर्माधिकारे नियुक्तः Ś.1 superintendence of religious matters. -2 Duty, office, charge; power, post of authority; authority; मन्त्राधि- कारः Kau. A.1 निर्णयाधिकारे ब्रवीमि M.1. I say this in the capacity of a judge; अविश्रमो$यं लोकतन्त्राधिकारः Ś.5; द्वीपिनस्ताम्बूलाधिकारो दत्तः Pt.1, तुल्योद्योगस्तव दिनकृतश्चाधिकारो मतो नः V.2.1.; अर्थ˚ administration of pecuniary matters स्वाधिकारात् प्रमत्तः Me.1; अधिकारे मम पुत्रको नियुक्तः M.5; यः सर्वाधिकारे नियुक्तः प्रधानमन्त्री स करोतु, अनुजीविना पर˚ चर्चा न कर्तव्या H.2; शिल्पाधिकारे योग्येयं दारिका M.1 fit to be initiated in to the fine arts. -3 Sovereignty, government or administration, jurisdiction, rule; स्वाधिकार- भूमौ वर्तिष्यते Ś.7 seat of government or jurisdiction, ˚खेदं निरूप्य Ś.5. -4 Position, dignity, rank; हृताधिकारां मलिनाम् Y.1.7 deprived of the position or rights or privileges of a wife. -5 (a) Right, authority, privilege, claim, title (as to wealth, property &c.); right of ownership or possession; अधिकारः फले स्वाम्यमथिकारी च तत्प्रभुः S. D.296; वत्से$धिकारः स्थितः Mv.4.38 it now belongs to the child. (b) Qualification or authority to perform certain specified duties, civil, sacrificial, religious &c.; as the अधिकार of a king to rule and protect, of a Brāhmaṇa to sacrifice, of a Vaiśya to till or trade &c.; शूद्रो$धिकारहीनो$पि Y.3.262; with loc.; निषेकादिस्मशा- नान्तो मन्त्रैर्यस्योदितो विधिः । तस्य शास्त्रे$धिकारो$स्मिन् ज्ञेयो नान्यस्य कस्यचित् Ms.2.16; श्राद्धाधिकारसम्पदस्तु इति भवन्तो ब्रुवन्तु (repeated in Śrāddha ceremonies). -6 Prerogative of a king. -7 Effort, exertion; कर्मण्येवाधिकारस्ते मा फलेषु कदाचन Bg.2.47 your business is with action alone &c. -8 Relation, reference; स राघवस्तत्र तदा प्रलापाञ् शुश्राव लोकस्य समागतस्य । आत्माधिकारा विविधाश्च वाचः Rām.2.17.43. कथा विचित्राः पृतनाधिकाराः Mb. -9 Place = अधिकरण; महत्खलु पुरुषाधिकारं ज्योतिः M.1. -1 A topic, paragraph or section; प्रायश्चित्त˚ Mit.; See अधिकरण. -11 Counting, enumeration, occasion for counting; संसत्सु जाते पुरुषाधिकारे Ki. 3.51 (गणनाप्रस्तावे). -12 (In gram.) A head or governing rule, which exerts a directing or governing influence over other rules; e. g. सर्वस्य द्वे P.VIII.1.1; समर्थानां प्रथमाद्वा; प्राग्दीव्यतो$ण् IV.1.82-3; तत्पुरुषः II. 1.22; अधिकारो$यं Sk. (This अधिकार is of three kinds; सिंहावलोकितं चैव मण्डूकप्लुतमेव च । गङ्गाप्रवाहवच्चापि अधिकारस्त्रिधा मतः ॥.) अधिकार also means a word or sūtra extending over in the following सूत्रs up to a particular limit. -Comp. -विधिः determination or statement of qualifications to do particular acts; as राजा राजसूयेन यजेत. -स्थ -आढ्य a. possessed of authority, invested with office. अधिकारिन् adhikārin अधिकारवत् adhikāravat अधिकारिन् अधिकारवत् a. [अस्त्यर्थे इनि मतुप् वा] 1 Possessed of authority, having power; निःस्पृहो नाधिकारी स्यात् Pt.1.164; सन्धिविग्रहकार्य˚, कार्य˚ H.3. -2 Entitled to, having a right to; सर्वे स्युरधिकारिणः; so उत्तराधिकारिन् heir; धनग्रहण˚ &c.; तपस्यनधिकारित्वात् R.15.51 not qualified or authorised. -3 Belonging to, owned by. -4 Fit for. -m. (री-वान्) 1 An official, officer; न निष्प्रयोजनम् अधिकारवन्तः प्रभुभिराहूयन्ते Mu.3; a functionary, superintendent, head, director, governor. -2 A rightful claimant, proprietor, master, owner. -3 One qualified to sacrifice or perform sacred works. -4 Man as the lord of creation. -5 One well versed in the Vedānta.
< अधिक्रम् 1 U. To ascend, mount upon. -2 To attack, scale. अधिक्रमः adhikramḥ क्रमणम् kramaṇam अधिक्रमः क्रमणम् An attack, invasion.
adhipraṣṭiyugam अधिप्रष्टियुगम् [प्रष्टौ निहितं युगम्] A yoke laid on the प्रष्टि or foremost of the three horses, used on certain sacrificial occasions. -गः The fourth horse thus attached (?)
adhiṣṭhānam अधिष्ठानम् [अधि-स्था-ल्युट्] 1 Standing or being near, being at hand, approach (सन्निधि); अत्राधिष्ठानं कुरु take a seat here. -2 Resting upon, occupying, inhabiting, dwelling in, locating oneself in; प्राणाधिष्ठानं देहस्य &c. -3 A position, site, basis, seat; त्र्यधिष्ठानस्य देहिनः Ms.12.4; इन्द्रियाणि मनो बुद्धिरस्याधिष्ठानमुच्यते Bg.3.4, 18.14 the seat (of that desire.) -4 Residence, abode; नगरं राजाधिष्ठानम् Pt.1.; so धर्म˚; a place, locality, town; सर्वाविनयाधिष्ठानतां गच्छन्ति K.16; कस्मिंश्चिदधिष्ठाने in a certain place. -5 Authority, power, power of control, presiding over; अनधिष्ठानम् H.3.83. lose of position, dimissal from a post (of authority); समर्थस्त्वमिमं जेतुमधिष्ठानपराक्रमैः Rām.; ययेह अश्वैर्युक्तो रथः सार- थिना$धिष्ठितः प्रवर्तते तथा आत्माधिष्ठानाच्छरीरम् Gaudapāda; महाश्वेताकृताच्च सत्याधिष्ठानात् K.346 appeal or reference to truth. -6 Government, dominion. -7 A wheel (of a car &c.) अधिष्ठानं मनश्चासीत्परिरथ्या सरस्वती Mb.8.34.34; 5.178.74. -8 A precedent, prescribed rule. -9 A benediction. cf. अधिष्ठानं चक्रपुरप्रभावाध्यासनेष्वपि । Nm. -1 Destruction (?); अमित्राणामधिष्ठानाद्वधाद् दुर्योधनस्य च । भीम दिष्ट्या पृथिव्यां ते प्रथितं सुमहद्यशः ॥ Mb.9.61.14. -11 Couch, seat, bed; साधिष्ठानानि सर्वशः Rām.6.75.19. -12 A butt (for an allurement.) तस्माद् ब्राह्ममधिष्ठानं कृत्वा कार्ये चतुर्विधे । Kau. A.1.1. -Comp. -अधिकरणम् Municipal Board. (अधिष्ठान = city; अधिकरण = court and office of administration) EI,XV, p.143; XVII. p. 193 f; XX, pp.61 ff. -शरीरम् A body which forms the medium between the subtle and the gross body.
anavakāśa अनवकाश a. [न. ब.] 1 Having no scope or occasion, uncalled for. -2 Inapplicable. -3 Having no opportunity or space. -शः [न. त.] Absence of room or scope.
anasūya अनसूय यक a. [न. ब.] Free from malice, not envious, not spiteful; श्रद्दधानो$नसूयश्च Ms.4.158; श्रद्धावाननसूयश्च शृणुयादपि यो नरः । Bg.18.71. -या [न. त.] 1 Absence of envy, charity of disposition, freedom from spite or illwill; न गुणान् गुणिनो हन्ति स्तौति चान्यगुणानपि । न हसेच्चान्यदो- षांश्च सानसूया प्रकीर्तिता. -2 N. of a friend of Śakuntalā. -3 N. of a daughter of Dakṣa. -4 N. of Atri's wife, the highest type of chastity and wifely devotion. [She was very pious and given to austere devotion by virtue of which she had obtained miraculous powers. Several stories are told o illustrate them. When the earth was devastated by a terrible drought which lasted for 1 years, Anasūyā created water, fruits, roots &c. by means of her ascetic powers and saved many lives. On one occasion when the sage Māṇḍavya was about to be impaled, the wife of a sage happened to touch the stake as she passed by, whereupon Māṇḍavya cursed her that she would become a widow at sunrise. She, however, prevented the sun from rising, and all actions of men being consequently stopped, the gods, sages &c. went to Anasūyā, her friend, who, by the force of her penance, made the sun rise without, at the same time, bringing widowhood on her friend. Another legend is also told in which Anasūyā changed Brahmā, Viṣṇu and Maheśa into infants, when, at the instigation of their wives, they attempted to test her chastity, but restored them to their former shapes at the importunities of their humbled consorts. She is also said to have caused the three-streamed Ganges to flow down on the earth near the hermitage of her husband for the ablutions of sages; see R.13.51. In the Rāmāyaṇa she is represented as having been very kind and attentive to Sītā whom she favoured with sound motherly advice on the virtues of chastity, and at the time of her departure gave her an unguent (See R.12.27,14.14) which was to keep her beautiful for ever and to guard her person from the attempts of rapacious beasts, demons &c. She was the mother of the irascible sage Durvāsas]. सा त्वेवमुक्ता वैदेही त्वनसूयानसूयया Rām.2.18.1.
anāyāsa अनायास a. Not troublesome or difficult, easy; ममाप्येक- स्मिन् ˚से कर्मणि त्वया सहायेन भवितव्यम् Ś.2. -सः 1 Facility, ease, absence of difficulty or exertion; शरीरं पीड्यते येन शुभेनाप्यशुभेन वा । अत्यन्तं तन्न कुर्वित अनायासः स उच्यते ॥ -2 Idleness, neglect; ˚सेन easily, without difficulty, readily. -Comp. -कृत a. done easily or readily. (-तम्) an infusion prepared without effort or exertion (prepared extemporaneously) अनायासकृतं फाण्टं Ak.2.94. See फाण्ट.
anārata अनारत a. 1 Not ceasing or stopping, continuous, uninterrupted. -2 Eternal. -तम् 1 Continuity. -2 Absolute non-entity (अत्यन्ताभाव). -adv. Continuously, always; eternally; अनारतं तेन पदेषु लम्भिताः Ki.1.15,4.
anāsādita अनासादित a. Not obtained, not found or met with; not encountered or attacked; not occurred or having happened, non-existent. -Comp. -विग्रह a. unused to war, having had no occasion to fight.
anāsthāna अनास्थान a. 1 Having no fixed seat or site. -2 having or yielding no basic or fulcrum, unfit for a fixed seat (as water); अनारम्भणे तदवीरयेथामनास्थाने अग्रभणे समुद्रे Rv.1.116.5.
anigraha अनिग्रह a. Unrestrained, invincible, unconquerable. -हः 1 Non-restraint. -2 Non-refutation. -3 Not admitting one's defeat in argument; ˚स्थानम् occasion of non-refutation.
anitya अनित्य a. 1 Not eternal or everlasting, transient, non-eternal, perishable (नश्वर) (opp. नित्य); गन्धवती पृथ्वी सा द्विविधा नित्या$नित्या च T. S.9 (अनित्या = कार्यरूपा); See नित्य; यदि नित्यमनित्येन निर्मलं मलवाहिना । यशः कायेन लभ्येत तन्न लब्धं भवेन्तु किम् ॥ H.1.45. रजस्वलमनित्यं च भूतावासमिमं त्यजेत् Ms.6.77; धर्मो$नित्यः सुखदुःखे$प्यनित्ये जीवो$नित्यो हेतुरस्या- प्यनित्यः Mb. -2 Occasional, temporary, casual; not peremptory or obligatory as a rule &c., special. -3 Unusual, extraordinary; वर्णे चानित्ये P.V.4.31 (लोहितकः कोपेन, अन्यथा तु श्वेतवर्ण इति भावः); आनाय्यो$नित्ये III.1.127 (स हि गार्हपत्यादानीयते$नित्यश्च सततमप्रज्वलनात् Sk.) See VI.1. 147. -4 Unsteady, fickle, not permanent; अनित्यं यौवनं रूपम् H.4.68; ˚हृदया हि ताः Rām. -5 Uncertain, doubtful; अनित्यो विजयो यस्माद् दृश्यते युध्यमानयोः Ms.7.199; विजयस्य ह्यनित्यत्वात् Pt.3.22. -6 (in grammar) A rule or operation which is not invariable or compulsory; optional. -त्यम् adv. Occasionally, not permanently, incidentally, casually; अनित्यं हि स्थितो यस्मात् Ms.3.12. -Comp. -कर्मन्, -क्रिया an occasional act, such as a sacrifice for a special purpose, a voluntary and occasional act. -दत्तः, -दत्तकः, -दत्रिमः a son given by his parents to another temporarily (for temporary or preliminary adoption). -प्रत्यवेक्षा (with Buddhists) the consciousness that everything is perishable and is passing away. -भावः transitoriness, transient state, limited nature or existence; so अनित्यतावम् frailty, instability. -समः a sophism or fallacious reasoning which generalizes what it is exceptional (as अनित्यत्वम्). -समासः a compound which it is not obligatory to form in every case (the sense of which may be equally expressed by resolving it into its constituent members.).
animitta अनिमित्त a, Causeless, groundless; casual, incidental; आलक्ष्यदन्तमुकुलाननिमित्तहासैः &Sacute.7.17; ˚त्तं मित्रम् disinterested, Dk.25; ˚उत्कण्ठा M.3.9. -त्तम् Absence of an adequate cause or occasion, causelessness, groundlessness. -2 A bad omen, ill-omen; चारुदत्तस्यैव दर्शनमनिमित्तं प्रमार्जयिष्यति Mk.6; ममानिमित्तानि हि खेदयन्ति 9.1; शमनार्थम् अनिमित्तस्य Ve.2.3. -3 Not a valid means of knowledge अनिमित्तं विद्यमानोपलम्भनात् MS.1.1.4. -adv., -˚तः Groundlessly, causelessly, without any adequate cause; अनिमित्तमिन्दु- वदने किमत्रभवतः पराङ्मुखीभवसि M.1.18; अनातुरः स्वानि रवानि न स्पृशेदनिमित्ततः Ms.4.144. -Comp. -निराक्रिया averting ill omens. -लिङ्गनाशः a kind of ophthalmic disease ending in total darkness. अनिमिषम् animiṣam षा ṣā मेषम् mēṣam अनिमिषम् षा मेषम् ind. Ved. Without winking, vigilantly; incessantly. नेमा आपो अनिमिषं चरन्तीः Rv.1. 24.6; अनिमेषं रक्षमाणस्तव व्रते Rv.1.31.12 and 164.21.
aniyata अनियत a. 1 Uncontrolled, unrestricted. -2 Indefinite, uncertain, not fixed; irregular (forms also); ˚वेलं आहारो$श्यते Ś.2 at irregular hours. -3 Causeless, casual, incidental, occasional; ˚रुदितस्मितम् (वदनकमलकम्) U.4.4; Māl.1.2. -Comp. -अङ्कः an indeterminate digit (in Math.) -आत्मन् a. not self-possessed, whose soul is not properly controlled. -पुंस्का a woman loose in conduct, unchaste. -वृत्ति a. 1 having no regular or fixed employment or application (as a word). -2 having no regular income.
anirvṛtiḥ अनिर्वृतिः त्तिः f. 1 Uneasiness, anxiety, disquietude. -2 Poverty, destitution; अनिर्वृतिनिशाचरी मम गृहान्तरालं गता Udb.
anistīrṇa अनिस्तीर्ण a. 1 Not crossed, set aside or got rid of -2 Unanswered, unrefuted (as a charge). -Comp. -अभियोगः a defendant who has not cleared himself of a charge (by refuting it).
anukāla अनुकाल a. [कालस्य योग्यः] Opportune, timely, adapted or suited to the time. -लम् ind. Opportunely, on a proper occasion.
anukūla अनुकूल a. [अनुगतः कूलं तटं स्नेहादिबन्धनं वा] 1 Favourable, agreeable (lit. following the bank of slope, according to the current, with the grain;), as wind, fate &c.; मन्दं मन्दं नुदति पवनश्चानुकूलो यथा त्वाम् Me.9; शान्त ˚पवनश्च Ś.4.11; ˚परिणामा संवृत्ता Ś.7; बाणास्त एव मदनस्य ममानुकूलाः V.3.2. -2 Friendly, kind, well or kindly disposed. -3 Conformable to; pleasing, agreeable or favourable to, conducting to, capable of; oft. in comp.; स्पर्शानुकूला इव सूर्यकान्ताः Ś.2.7; अननुकूलो$भिमानस्य K.45 not inclined to pride; दर्शनानुकूलाहमस्य न वेति 197; कुशलविरचितानुकूलवेशः R.5.76 befitting, suitable. -लः 1 A faithful or kind husband, (एकरतिः S. D. or एकनिरतः एकस्यामेव नायिकायाम् आसक्तः), a variety of नायक. -2 'Favourable to all', epithet of Viṣṇu. -ला 1 N. of a tree (दन्ती) Croton Polyandrum. -2 N. of a metre. -लम् 1 Favour, kindness; नारीणामनुकूलमाचरति चेत् K. P.9. -2 (Rhet.) A figure in which unfavourableness turns into kindness; अनुकूलं प्रतिकूल्यमानुकूल्यानुबन्धि चेत् S. D.; कुपितासि यदा तन्वि निधाय करजक्षतम् । बधान भुजपाशाभ्यां कण्ठमस्य दृढं तदा ॥.
anugata अनुगत p. p. 1 (Used passively) (a) Followed (lit. & fig.), attended; अनुगतमलिवृन्दैर्गण्डभित्तीर्विहाय R.12. 12; M.3.9; मद्यानुगतभोजनं मलावहम् Ms.11.7. (b) Full of, filled with; दारिद्य्रेणाभिभूतेन त्वत्स्नेहानुगतेन च Mk.4.5; वर्ष- धरकलमूकानुगतेन परिजनेन K.159 consisting or made up of; चिन्तानुगतसर्वात्मन् Mb. (c) Covered, as by a dress hanging behind; शिवमिवानुगतं गजचर्मणा Ki.5.2 (पश्चाद्व्याप्तम्). (d) Extinguished &c. (e) Acquired, obtained. (f) Overtaken; कालेनानुगतो ह्यसि Rām.7.68.6. -2 (Used actively) (a). Following, obeying; observing; स्वमत- मनुगतः Mu.5.19; विभवानुगता भार्या Mk.3.28; दिग्विजय- प्रसङ्गेनानुगतो भूमिमिमाम् K.191 come to; Ms.9.267; K.166; Mu.6.5; H.2.55; R.15.9. (b) Corresponding or tallying with, adapted or answering to, in harmony with; सूत्रेणानुगतं भवति Ś.B.; पादन्यासो लय- मनुगतः M.2.8 in accompaniment to the musical time. मृदङ्ग ˚तः सङ्गीतमधुरः Ratn.1; ˚वीणैः Śi.11.1. (c) Adequate or suitable to, fit for; प्रस्तावानुगतं पृष्टः Pt.5. (d) Imitating; परितुष्टो$स्मि यत्पितरमनुगतो वत्सः M.5. I am glad that the boy takes after his father. -तम् Moderate time in music. -Comp. -अर्थ a. having a corresponding or easily discoverable sense.
anuguṇa अनुगुण a. [अनुकूलो गुणो यस्य] Having similar qualities, of the same nature; कान्तारतापसाविक्षू वंशकानुगुणौ स्मृतौ Susr.; conformable to, favourable or agreeable to, suitable, according to; मनोरथस्यानुगुणं सर्वदा यस्य चेष्टितम् Mv.7.7 obedient to the will 7.38; गुणसम्पदानुगुणतां गमितः Ki.6.33;1.13; congenial, suitable, fit; ˚अन्न- लाभात् Dk.64,94; अननुगुणदाराणाम् Dk.13 not having wives worthy of themselves; (वीणा) उत्कण्ठितस्य हृदयानुगुणा वयस्या Mk.3.3 agreeable or pleasing to the heart, exactly after the heart (Tv. here takes ˚णा mean तन्त्रीयुक्तवीणा itself); अत्र द्वावप्युपध्मानीयावेव न शान्तानुगुणौ R. G.; रसानुगुणतामेति S. D.; ˚णं सर्वास्ववस्थासु यत् U.1.39. -णः A natural peculiarity. -णम् adv. 1 Favourably, conformably to one's desires; चिरेणानुगुणं प्रोक्ता प्रतिपत्तिपराङ्मुखी Bk.8.95. -2 Agreeably or conformably to (in comp.); तदादेशानुगुणं भवदागमनमभूत् Dk. 11. -3 Naturally.
anuttara अनुत्तर a. [नास्ति उत्तरो यस्मात्] 1 Principal, chief. -2 Best, excellent; अनुत्तराणि विलसितानि Dk.162 unsurpassed. शरीरसौख्यार्थमनुत्तरस्य निपेततुर्मूर्धनि तस्य सौम्ये । Bu. ch.1.35. -3 [नास्ति उत्तरं यस्य] Without a reply, silent, unable to answer; भवत्यवज्ञा च भवत्यनुत्तरात् Naiṣadha. -4 Fixed, firm (न उत्तरति चलति). अर्थ्यं तथ्यं हितं वाक्यं लघुयुक्तमनुत्तरम् Mb.2.2.5. -5 Low, inferior, base, mean. -6 Southern. -रम् [न. त.] No reply, a reply which, being evasive, is considered to be no reply. -राः (pl.) A class of gods among Jainas (˚उपपातिक). -उपपातिकदशाः f. Title of the ninth aṅga of the Jainas treating of those gods. -रा The south. ...अनुत्तरः । नोदीच्यां नोपरि श्रेष्ठे...। Nm. -Comp. -योगतन्त्रम् Title of the last of the four Bauddhatantras.
anunaya अनुनय a. [नी-अच्] Kind, conciliatory, pacifying (as words). तुल्यदुःखो$ब्रवीद्भ्राता लक्ष्मणो$नुनयं वचः Rām.4.27.33. -यः 1 Conciliation, propitiation, pacification (of anger), friendly persuasion; कथं नु शक्यो$नुनयो महर्षेर्विश्राणना- च्चान्यपयस्विनीनाम् R.2.54; कथं वा तेषामनुनयः कृतः H.4; प्रकृति- वक्रः स कस्यानुनयं प्रितगृह्णाति Ś.4. -2 Courtesy, civility, courteous or polite behaviour, modesty, modest or respectful deportment, conciliatory act (such as salutation); showing respect (to a guest, deity &c.); विविधैरनुतप्यन्ते दयितानुनयैर्मनस्विन्यः V.3.5; दयितजनः˚ 2. 22; वाक्यैः स्निग्धैरनुनयो भवेदर्थस्य साधनम् S. D.458. -3 An humble supplication or entreaty, a request in general; भद्र प्रियं नः कींतु त्वदभिप्रायापरिज्ञानान्तरितो$यमस्मदनुनयः Mu.2; R.6.2; निषेधवाक्यालङ्कारजिज्ञासानुनये खलु Ak; ˚आम- न्त्रणम् conciliatory address. -4 Discipline, training, regulation of conduct. -यम् adv. Fitly, suitably.
anurañjaka अनुरञ्जक a. Gratifying, pleasing.
anurañjanam अनुरञ्जनम् Conciliating, satisfying, gratifying, pleasing, keeping contented; युक्तः प्रजानामनुरञ्जने स्याः U.1.11.
anuvṛttiḥ अनुवृत्तिः f. 1 Assenting to, approval; तवानुवृत्तिं न च कर्तुमुत्सहे Ku.5.65. -2 Obedience, conformity, following, continuance in (opp. व्यावृत्ति); taking up; continuity; ज्येष्ठानुवृत्तिजटिलम् R.13.78 by following the example of; अनुवृत्त्या प्रमार्ष्टुमागतः Dk.1 service; cf. also वाचानुवृत्तिः खलु अतिथिसत्कारः Pratimā 5. ततान वह्निः पवनानुवृत्त्या Ki.16.52 in consequence of. -3 Acting according or suitably to, compliance, acquiescence; gratifying, pleasing; कान्ता˚ - चातुर्यमपि शिक्षितं वत्सेन U.3; Māl.9; Śi.9.58; K.265; M.2.9; राज्यं हि नाम राजधर्म˚ परस्य नृपतेर्महदप्रीतिस्थानम् Mu.3 who conforms to or is true to the duties of kings; (previous) compliant or obedient spirit, previous course of conduct; U.7.5. -4 Rememberance आसेदुषां गोत्रभिदो$- नुवृत्त्या Ki.18.18. -5 (Gram.) Being supplied or repeated in a following rule; continued influence of a preceding on a following rule. -6 Imitating, resembling &c. -7 Repetition; वर्णानामनुवृत्तिरनुप्रासः.
anuvṛddhi अनुवृद्धि a. Ved. Increasing in regular ratio.
anuśāsanam अनुशासनम् Advice, persuasion, direction, order. command; instruction, laying down rules or precepts; a law, rule, precept; treatment (of a subject), (with the object in comp. or with gen., the agent, if expressed, being put in the instr. or gen.); एतद्वै भद्रमनुशासनस्य Rv.1.32.7. एतदनुशासनम् Tait. Up.7.9.7. भवत्यधिक्षेप इवानुशासनम् Ki.1.28 words of advice; तन्मनोरनुशासनम् Ms.8.139;6.5;2.159; यौवन˚ K.146; नामलिङ्ग˚ laying down rules on the gender of nouns, explanation of gender &c.; शब्दानुशासनम् Sk.; शब्दानामनुशासनमाचार्यस्य आचार्येण वा P.II.3.66 Sk. -Comp. -पर a. obedient. -पर्वन् N. of the 13th book of the Mahābhārata (so called because it lays down precepts of advice).
anusaṃcaraṇam अनुसंचरणम् Following, pursuing. -adv. At every occasion of coming.
anaikānta अनैकान्त a. Variable, uncertain, unsteady; occasional, casual (as a cause not invariably attended by the same effects.).
anta अन्त a. [अम्-तन् Uṇ.3.86] 1 Near. -2 Last. -3 Handsome, lovely; Me.23; दन्तोज्ज्वलासु विमलोपलमे- खलान्ताः Śi.4.4, (where, however, the ordinary sense of 'border' or 'skirt' may do as well, though Malli. renders अन्त by रम्य, quoting the authority of शब्दार्णव - 'मृताववसिते रम्ये समाप्तावन्त इष्यते'). -4 Lowest, worst. -5 Youngest. -तः (n. in some senses) 1 (a) End, limit, boundary (in time or space); final limit, last or extreme point; स सागरान्तां पृथिवीं प्रशास्ति H.4.5 bounded by the ocean, as far as the sea; अपाङ्गौ नेत्रयो- रन्तौ Ak.; उद्युक्तो विद्यान्तमधिगच्छति H.3.114 goes to the end of, masters completely; श्रुतस्य यायादयमन्तमर्भकस्तथा परेषां युधि चेति पार्थिवः (where अन्त also means end or destruction); जीवलोकसुखानामन्तं ययौ K.59 enjoyed all worldly pleasures; आलोकितः खलु रमणीयानामन्तः K.124 end, furthest extremity; दिगन्ते श्रूयन्ते Bv.1.2. -2 Skirt, border, edge, precinct; a place or ground in general; यत्र रम्यो वनान्तः U.2.25 forest ground, skirts of the forest; ओदकान्तात् स्निग्धो जनो$नुगन्तव्यः Ś.4; उपवनान्तलताः R.9.35 as far as the borders or skirts; वृत्तः स नौ संगतयोर्वनान्ते R.2.58,2.19; Me.23. Upper part (शिरोभाग); महा- र्हमुक्तामणिभूषितान्तम् Rām.5.4.3. -3 End of a texture, edge, skirt, fringe or hem of a garment; वस्त्र˚; पवनप्रनर्तितान्तदेशे दुकूले K.9 (by itself in Veda). -4 Vicinity, proximity, neighbourhood, presence; नाधीयीत श्मशानान्ते ग्रामान्ते Ms. 4.116; Y.2.162; जलान्ते छन्दसां कुर्यादुत्सर्गं विधिवद् बहिः 1.143; गङ्गाप्रपातान्तविरूढशष्पम् (गह्वरम्) R.2.26; पुंसो यमान्तं व्रजतः P.2.115 going into the vicinity or presence of Yama; अन्योन्यामन्त्रणं यत्स्याज्जनान्ते तज्जनान्तिकम् S. D.; यां तु कुमारस्यान्ते वाचमभाषथास्तां मे ब्रूहि Śat. Br. (These four senses are allied). -5 End, conclusion, termination (opp. आरम्भ or आदि); सेकान्ते R.1.51; दिनान्ते निहितम् R.4.1; मासान्ते, पक्षान्ते, दशाहान्ते &c.; एकस्य दुःखस्य न यावदन्तं गच्छाम्यहं पारमिवार्णवस्य Pt.2.175; व्यसनानि दुरन्तानि Ms.7.45; दशान्तमुपेयिवान् R.12.1 going to the end of the period of life (end of the wick); व्यसनं वर्धयत्येव तस्यान्तं नाधिगच्छति Pt.2.18; oft. in comp. in this sense, and meaning 'ending in or with', 'ceasing to exist with', 'reaching to the end'; तदन्तं तस्य जीवितम् H.1.91 ends in it; कलहान्तानि हर्म्याणि कुवाक्यान्तं च सौहृदम् । कुराजान्तानि राष्ट्राणि कुकर्मान्तं यशो नृणाम् ॥ Pt.5.76; विशाखान्ता गता मेघा प्रसूत्यन्तं च यौवनम् । प्रणामान्तः सतां कोपो याचनान्तंहि गौरवम् ॥ Subhā. फलोदयान्ताय तपःसमाधये Ku.5.6 ending with (lasting till) the attainment of fruit; यौवनान्तं वयो यस्मिन् Ku.6.44; R.11.62,14.41; विपदन्ता ह्यविनीतसंपदः Ki.2.52; युगसहस्रान्तं ब्राह्मं पुण्यमहर्विदुः Ms.1.73 at the end of 1 Yugas; प्राणान्तं दण़्डम् Ms.8.359 capital punishment (such as would put an end to life). -6 Death, destruction; end or close of life; धरा गच्छत्यन्तं Bh.3.71 goes down to destruction; योगेनान्ते तनुत्यजाम् R.1.8; एका भवेत्स्वस्तिमती त्वदन्ते 2.48;12.75; ममाप्यन्ते Ś.6; अद्य कान्तः कृतान्तो वा दुःखस्यान्तं करिष्यति Udb.; औषध्यः फलपाकान्ताः Ms.1.46; अन्तं या To be destroyed, perish, be ruined. -7 (In gram.) A final syllable or letter of a word; अजन्त ending in a vowel; so हलन्त, सुबन्त, तिडन्त &c. -8 The last word in a compound. -9 Ascertainment, or settlement (of a question); definite or final settlement; pause, final determination, as in सिद्धान्त; न चैव रावणस्यान्तो दृश्यते जीवितक्षये Rām.6.17.58 उभयोरपि दृष्टोन्तस्त्वनयोस्तत्त्वदर्शिभिः Bg.2.16 (सदसतोः इत्यर्थः). -1 The last portion or the remainder (n. also); निशान्तः; वेदान्तः &c. वेदांश्चैव तु वेदाङ्गान् वेदान्तानि तथा स्मृतीः । अधीत्य ब्राह्मणः पूर्वं शक्तितो$न्यांश्च संपठेत् ॥ Bṛihadyogi- yājñavalkya Smṛiti 12.34. -11 Underneath, inside, inner part; युष्मदीयं च जलान्ते गृहम् Pt.4 in water, underneath water; सुप्रयुक्तस्य दम्भस्य ब्रह्माप्यन्तं न गच्छति Pt.1.22 does not penetrate or dive into, sound, fathom; आशङ्कितस्यान्तं गच्छामि M.3 shall dive deep into, fully satisfy, my doubts. -12 Total amount, whole number or quantity. -13 A large number. -14 Nature, condition; sort, species; मम मोक्षस्य को$न्तो वै ब्रह्मन्ध्यायस्व वै प्रभो Mb.12.282.32. एतदन्तास्तु गतयो ब्रह्माद्याः समुदाहृताः Ms.1.5. -15 Disposition; essence; शुद्धान्तः -16 Division (विभाग); ते$नया कात्यायन्या$न्तं करवाणीति Bri. Up.2.4.1. [cf. Goth. andeis, and; Germ. ende and ent; also Gr. anti; L. ante]. cf. अन्तस्तु भागे$- वसिते रचनायां च तत्परे । मृतौ निषेवणे रम्ये समाप्तावग्रमध्ययोः ॥ स्वरूपे च समीपे च पुंलिङ्गे$पि प्रकीर्तितः । Nm. -Comp. -अवशा- यिन् m. [अन्ते पर्यन्तदेशे अवशेते] a chāṇḍāla. -अवसायिन् [नखकेशानामन्तं अवसातुं छेत्तुं शीलमस्य, सो-णिनि] 1 a barber. -2 a chāṇḍāla, low caste. -3 N. of a sage, see अन्त्याव- सायिन् (अन्ते पश्चिमे वयसि अवस्यति तत्त्वं निश्चिनोति). -उदात्त a. having the acute accent on the last syllable. (-त्तः) the acute accent on the last syllable; P.VI,1.199. -ओष्ठः The lower lip (अधरोष्ठ); रुधिरं न व्यतिक्रामदन्तोष्ठादम्ब मा शुचः Mb.11.15.16. -कर, -करण,-कारिन् a. causing death or destruction, fatal, mortal, destructive; क्षत्रिया- न्तकरणो$पि विक्रमः R.11.75 causing the destruction of; राज्यान्तकरणावेतौ द्वौ दोषौ पृथिवीक्षिताम् Ms.9.221; अहमन्तकरो नूनं ध्वान्तस्येव दिवाकरः Bk. -कर्मन् n. death, destruction; षो अन्तकर्मणि Dhātupāṭha. -कालः, -वेला time or hour of death; स्थित्वा स्यामन्तकाले$पि ब्रह्मनिर्वाणमृच्छति Bg.2.72. -कृत् m. death; वर्जयेदन्तकृन्मर्त्यं वर्जयेदनिलो$नलम् Rām. -कृद्दशाः N. of the eighth of the twelve sacred Aṅga texts of the Jainas (containing ten chapters). -ग a. having gone to the end of, thoroughly conversant or familiar with, (in comp.); शाखान्तगमथाध्वर्युम् Ms.3.145. -गति, -गामिन् a. perishing. प्राप्तो$न्तगामी विपरीतबुद्धिः Rām.6.59.94. -गमनम् 1 going to the end, finishing, completing; प्रारब्धस्य ˚नं द्वितीयं बुद्धिलक्षणम् -2 death, perishing, dying. -चक्रम् Reading of omens and augury; Kau. A. -चर a. 1 walking about, going to the borders or frontiers. -2 completing or finishing (as a business &c.). -ज a. last born. -दीपकम् a figure of speech (in Rhetoric). -परिच्छदः a. cover, covering utensil. राजतान्तपरिच्छदां दिव्यपायससंपूर्णां पात्रीम् Rām.1.16.14. -पालः 1 a frontier-guard, guarding the frontiers; विनीतैरन्तपालैश्च रक्षोभिश्च सुरक्षितम् Rām.5.6.9. ˚दुर्गे M.1; त्वदीयेनान्तपाले- नावस्कन्द्य गृहीतः ibid. -2 a door-keeper (rare). सुद्युम्न- स्त्वन्तपालेभ्यः श्रुत्वा लिखितमागतम् Mb.12.23.29. -भव, -भाज् a. being at the end, last. -लीन a. hidden, con- cealed. -लोपः dropping of the final of a word. (न्ते˚) -वासिन् a. dwelling near the frontiers, dwelling close by. -m. [अन्ते गुरुसमीपे वस्तुं शीलं यस्य] 1 a pupil (who always dwells near his master to receive instruction); P.IV.3.14;VI.2.36.; Ms.4.33. -2 a chāṇḍāla (who dwells at the extremity of a village). -वेला = ˚कालः q. v. -व्यापत्तिः f. change of the final syllable, as in मेघ from मिह् Nir. -शय्या 1 a bed on the ground. -2 the last bed, death-bed; hence death itself. -3 a place for burial or burning. -4 a bier or funeral pile. -संश्लेषः union (सन्धि), joint; सुखदुःखान्तसंश्लेषम् (काल- चक्रम्) Mb.14.45.3. -सत्क्रिया last rites, funeral ceremonies, obsequies. -सढ् m. pupil; तमुपासते गुरुमिवा- न्तसदः Ki.6.34. -स्वरितः the svarita accent on the last syllable of a word.
antar अन्तर् ind. [अम्-अरन्-तुडागमश्च Uṇ.5.6, अमेस्तुट् च] 1 (Used as a prefix to verbs and regarded as a preposition or गति) (a) In the middle, between; in, into, inside; ˚हन्, ˚धा, ˚गम्, ˚भू, ˚इ, ˚ली &c. (b) Under. -2 (Used adverbially) (a) Between, betwixt, amongst, within; in the middle or interior, inside (opp. वहिः); अदह्यतान्तः R.2.32 burnt within himself, at heart; अन्तरेव विहरन् दिवानिशम् R.19.6 in the palace, in the harem; so ˚भिन्नं भ्रमति हृदयम् Māl. 5.2; अन्तर्विभेद Dk.13; यदन्तस्तन्न जिह्वायाम् Pt.4.88; अन्तर्यश्च मृग्यते V.1.1 internally, in the mind. (b) By way of seizing or holding; अन्तर्हत्वा गतः (हतं परिगृह्य). -3 (As a separable preposition) (a) In, into, between, in the middle, inside, within, (with loc.); निवसन्नन्तर्दारुणि लङ्घ्यो वह्निः Pt.1.31; अन्तरादित्ये Ch. Up., अन्तर्वेश्मनि Ms.7 223; Y.3.31; अप्स्वन्तरमृतमप्सु Rv.1. 23.19. अप्सु मे सोमो$ब्रवीदन्तर् विश्वानि भेषजा ibid. (b) Between (with acc.) Ved. अन्तर्मही बृहती रोदसीमे Rv. 7.87.2; अन्तर्देवान् मर्त्यांश्च 8.2.4; हिरण्मय्योर्ह कुश्योरन्तर- वहित आस Śat. Br. (c) In, into, inside, in the interior, in the midst (with gen.); प्रतिबलजलधेरन्तरौर्वायमाणे Ve. 3.7; अन्तःकञ्चुकिकञ्चुकस्य Ratn.2.3; बहिरन्तश्च भूतानाम् Bg.13.15; त्वमग्ने सर्वभूतानामन्तश्चरसि साक्षिवत् Y.2.14; लघुवृत्तितया भिदां गतं बहिरन्तश्च नृपस्य मण्डलम् Ki.2.53; अन्तरीपं यदन्तर्वारिणस्तटम् Ak.; oft. in comp. at the end; कूपान्तः पतितः Pt.5; सभान्तः साक्षिणः प्राप्तान् Ms.8.79; दन्तान्तरधि- ष्ठितम् Ms.5.141 between the teeth; उत्पित्सवो$न्तर्नदभर्तुः Śi.3.77; also in compound with a following word; अहं सदा शरीरान्तर्वासिनी ते सरस्वती Ks.4.11. -4 It is frequently used as the first member of compounds in the sense of 'internally', 'inside', 'within', 'in the interior', 'having in the interior', 'filled with', 'having concealed within', or in the sense of 'inward', 'internal', 'secret', 'hidden' &c., forming Adverbial, Bahuvrīhi or Tatpuruṣa compounds; कुन्दमन्तस्तुषारम् (Bah. comp.) Ś.5.19 filled with dew; ˚स्तोयम् (Bah. comp.) Me.66; अन्तर्गिरि (Adv. comp.) Ki.1.34; ज्वलयति तनूमन्तर्दाहः (Tat. comp.) U.3.31; so ˚कोपः, ˚कोणः, ˚आकूतम् &c. -5 It is also supposed to be a particle of assent (स्वीकारार्थक). (Note. In comp. the र् of अन्तर् is changed to a visarga before hard consonants, as अन्तः- करणम्, अन्तःस्थ &c.). [cf. L. inter; Zend antare; Goth. undar; Pers. andar; Gr. entos;]. -Comp. -अंसः the breast (= अंतरा-अंस q. v.). -अग्निः inward fire, the fire which stimulates digestion; दीप्तान्तरग्निपरिशुद्धकोष्ठः Susr. -अंङ्ग a. 1 inward, internal, comprehended, included (with abl.); त्रयमन्तरङ्ग पूर्वेभ्यः Pat Sūtra. -2 proximate, related to, essential to or referring to the essential part of the अङ्ग or base of a word (opp. बहिरङ्ग); धातूपसर्गयोः कार्यमन्तरङ्गम् P.VIII.3.74 Sk. -3 dear, most beloved (अत्यन्तप्रिय); स्वपिति सुखमिदा- नीमन्तरङ्गः कुरङ्गः Ś.4.v.l. (-अङ्गम्) 1 the inmost limb or organ, the heart, mind; सन्तुष्टान्तरङ्गः Dk.11; ˚वृत्ति 21; the interior. -2 an intimate friend, near or confidential person (forming, as it were, part of oneself); मदन्तरङ्गभूताम् Dk.81,93,11; राजान्तरङ्गभावेन 135; अन्तरङ्गेषु राज्यभारं समर्प्य*** 159. -3 an essential or indispensable part, as श्रवण, मनन & निदिध्यासन in realizing Brahman. -4 What is intimately connected or related; अन्तरङ्गबहिरङ्ग- योरन्तरङ्ग बलीयः ŚB. on MS.12.2.29. -अवयव an inner part; P.V.4.62. -आकाशः the ether or Brahman that resides in the heart of man (a term often occurring in the Upaniṣads). -आकूतम् secret or hidden intention. -आगमः an additional augment between two letters, -आगारम् the interior of a house; स्त्रीनक्तमन्तरा- गारबहिःशत्रुकृतांस्तथा Y.2.31. -आत्मन् m. (त्मा) 1 the inmost spirit or soul, the soul or mind; also the internal feelings, the heart, अङ्गुष्ठमात्रपुरुषोन्तरात्मा Śvet.; नास्य प्रत्यक- रोद्वीर्यं विक्लवेनान्तरात्मना Rām.6.13.28. गतिमस्यान्तरात्मनः Ms.6.73; जीवसंज्ञोन्तरात्मान्यः सहजः सर्वदेहिनाम् 12.13; मद्- गतेनान्तरात्मना Bg.6.47 with the heart fixed on me; जातो ममायं विशदः प्रकामं ...... अन्तरात्मा Ś.4.22, U.3.38, प्रायः सर्वो भवति करुणावृत्तिरार्द्रान्तरात्मा Me.95. -2 (In phil.) the inherent supreme spirit or soul (residing in the interior of man); अन्तरात्मासि देहिनाम् Ku.6.21. -आपणः a market in the heart (inside) of a town. -आय, -आल; See s. v. -आराम a. rejoicing in oneself, finding pleasure in his soul or heart; यो$न्तःसुखोन्तरारामस्तथान्तर्जर्यो- तिरेव सः Bg.5.24. -इन्द्रियम् an internal organ or sense. -उष्यम् Ved. a secret abode. -करणम् the internal organ; the heart, soul; the seat of thought and feeling, thinking faculty, mind, conscience; प्रमाणं ˚प्रवृत्तयः Ś.1.22; सबाह्य ˚णः अन्तरात्मा V.4 the soul in all its senses external and internal, the inner and outer man; दयार्द्रभावमाख्यातमन्तःकरणैर्विशङ्कैः R.2.11. According to the Vedānta अन्तःकरण is of four kinds : मनो बुद्धिरहङ्कार- श्चित्तं करणमान्तरम् । संशयो निश्चयो गर्वः स्मरणं विषया इमे ॥ अन्तःकरणं त्रिविधम् Sāṅkhya 33, i. e. बुद्धयहङ्कारमनांसि; सान्तःकरणा बुद्धिः 35, i. e. अहङ्कारमनःसहिता. -कल्पः a certain number of years (with Buddhists). -कुटिल a. inwardly crooked (fig. also); fraudulent. (-लः) a conch-shell. -कृ(क्रि)मिः a disease of worms in the body. -कोटरपुष्पी = अण्ड- कोटरपुष्पी. -कोपः 1 internal disturbance; H.3. -2 inward wrath, secret anger. -कोशम् the interior of a storeroom. -गङ्गा the secret or hidden Ganges (supposed to communicate uuderground with a secret stream in Mysore). -गडु a. [अन्तर्मध्ये गडुरिव] useless, unprofitable, unnecessary, unavailing; किमनेनान्तर्गडुना Sar. S. (ग्रीवाप्रदेश- जातस्य गलमांसपिण्डस्य गडोर्यथा निरर्थकत्वं तद्वत्). -गम् -गत &c. See under अंतर्गम्. -गर्भ a. 1 bearing young, pregnant. -2 having a गर्भ or inside; so ˚गर्भिन्. -गिरम् -रि ind. in mountains. अध्यास्तेन्तर्गिरं यस्मात् करतन्नावैति कारणम् Bk.5.87. -गुडवलयः the sphincter muscle. -गूढ a. concealed inside, being inward; ˚घनव्यथः U.3.1; R.19.57; ˚विषः with poison concealed in the heart. -गृहम्, -गेहम्, -भवनम् [अन्तःस्थं गृहम् &c.] 1 the inner apartment of a house, the interior of a house. -2 N. of a holy place in Benares; पञ्चक्रोश्यां कृतं पापमन्तर्गेहे विनश्यति. -घणः -णम् [अन्तर्हन्यते क्रोडीभवत्यस्मिन्, निपातः] the open space before the house between the entrance-door and the house (= porch or court); तस्मिन्नन्तर्घणे पश्यन् प्रघाणे सौधसद्मनः Bk.7.62 द्वारमतिक्रम्य यः सावकाशप्रदेशः सो$न्तर्घणः). (-नः -णः) N. of a country of Bāhīka (or Bālhīka) (P.III.3.78 बाहीकग्रामविशेषस्य संज्ञेयम् Sk.). -घातः striking in the middle Kāsi. on P.III.3.78. -चर a. pervading the body. internally situated, internal, inward अन्तश्चराणां मरुतां निरोधात् Ku.3.48; U.7. -ज a. born or bred in the interior (as a worm &c.). -जठरम् the stomach. (ind.) in the stomach. -जम्भः the inner part of the jaws (खादनस्थानं जम्भः, दन्तपङ्क्त्यो- रन्तरालम्). -जात a. inborn, innate. -जानु ind. between the knees. -जानुशयः One sleeping with hands between the knees; अन्तर्जानुशयो यस्तु भुञ्जते सक्तभाजनः Mb.3.2.75. -ज्ञानम् inward or secret knowledge. -ज्योतिस् a. enlightened inwardly, with an enlightened soul. यो$न्तःसुखो$न्तरारामस्तथान्तर्ज्योतिरेव यः Bg.5.24. (-स् n.) the inward light, light of Brahman. -ज्वलनम् inflammation. (-नः) inward heat or fire; mental anxiety. -ताप a. burning inwardly (-पः) internal fever or heat Ś.3.13. -दधनम् [अन्तर्दध्यते आधीयते मादकतानेन] distillation of spirituous liquor, or a substance used to produce fermentation. -दशा a term in astrology, the time when a particular planet exercises its influence over man's destiny (ज्योतिषोक्तः महादशान्तर्गतो ग्रहाणां स्वाधिपत्यकालभेदः). -दशाहम् an interval of 1 days; ˚हात् before 1 days. Ms.8.222; ˚हे 5.79. -दहनम् -दाहः 1 inward heat; ज्वलयति तनूमन्तर्दाहः U.3.31; ˚हेन दहनः सन्तापयति राघवम् Rām. -2 inflammation. -दुःख a. sad or afflicted at heart; -दुष्ट a. internally bad, wicked or base at heart. -दृष्टिः f. examining one's own soul, insight into oneself. -देशः an intermediate region of the compass. -द्वारम् private or secret door within the house (प्रकोष्ठद्वारम्). -धा-धि, -हित &c. See. s. v. -नगरम् the palace of a king (being inside the town); cf. ˚पुरम्; दशाननान्तर्नगरं ददर्श Rām. -निवेशनम् inner part of the house; यथा चारोपितो वृक्षो जातश्चान्तर्निवेशने Rām.6.128.6. -निहित a. being concealed within; अङ्गैरन्तर्निहितवचनैः सूचितः सम्यगर्थः M.2.8. -निष्ठ a. engaged in internal meditation. -पटः, -टम् a screen of cloth held between two persons who are to be united (as a bride and bridegroom, or pupil and preceptor) until the acctual time of union arrives. -पथ a. Ved. being on the way. -पदम् ind. in the interior of an inflected word. -पदवी = सुषुम्णामध्यगतः पन्थाः -पिरधानम् the innermost garment. -पर्शव्य a. being between the ribs (as flesh). -पवित्रः the Soma when in the straining vessel. -पशुः [अन्तर्गाममध्ये पशवो यत्र] the time when the cattle are in the village or stables (from sunset to sunrise); अन्तःपशौ पशुकामस्य सायं प्रातः Kāty; (सायं पशुषु ग्राममध्ये आगतेषु प्रातश्च ग्रामादनिःसृतेषु com.). -पातः, पात्यः 1 insertion of a letter (in Gram.). -2 a post fixed in the middle of the sacrificial ground (used in ritual works); अन्तःपूर्वेण यूपं परीत्यान्तःपात्यदेशे स्थापयति Kāty. -पातित, -पातिन् a. 1 inserted. -2 included or comprised in; falling within; दण्डकारण्य˚ ति आश्रमपदम् K.2. -पात्रम् Ved. interior of a vessel. -पालः one who watches over the inner apartments of a palace. -पुरम् [अन्तः अभ्यन्तरं पुरं गृहम्, or पुरस्यान्तःस्थितम्] 1 inner apartment of a palace (set apart for women); female or women's apartments, seraglio, harem (so called from their being situated in the heart of the town, for purposes of safety); व्यायम्याप्लुत्य मध्याह्ने भोक्तुमन्तःपुरं विशेत् Ms.7.216,221,224; कन्यान्तःपुरे कश्चित्प्रविशति Pt.1. -2 inmates of the female apartments, a queen or queens, the ladies taken collectively; अन्तःपुराणि सर्वाणि रुदमानानि सत्वरम् Rām.6.111.111. ˚विरहपर्युत्सुकस्य राजर्षेः Ś.3; K.58; ततो राजा सान्तःपुरः स्वगृह- मानीयाभ्यर्चितः Pt.1; कस्यचिद्राज्ञो$न्तःपुरं जलक्रीडां कुरुते ibid. ˚प्रचारः gossip of the harem Ms.7.153; ˚समागतः Ś.4; also in pl.; कदाचिदस्मत्प्रार्थनामन्तःपुरेभ्यः कथयेत् Ś.2.; न ददाति वाचमुचितामन्तःपुरेभ्यो यदा Ś.6.5. ˚जन women of the palace; inmates of the female apartments; ˚चर, -अध्यक्षः-रक्षकः, -वर्ती guardian or superintendent of the harem, chamberlain; वृद्धः कुलोद्रतः शक्तः पितृपैतामहः शुचिः । राज्ञामन्तःपुरा- ध्यक्षो विनीतश्च तथेष्यते ॥ (of these five sorts are mentioned :- वामनक, जघन्य, कुब्ज, मण्डलक and सामिन् see Bṛi. S.) ˚सहायः one belonging to the harem. -पुरिकः [अन्तःपुरे नियुक्तः, ठक्] a chamberlain = ˚चर. (-कः, -का) a woman in the harem; अस्मत्प्रार्थनामन्तःपुरिके(का) भ्यो निवेदय Chaṇḍ. K. -पुष्पम् [कर्म.] the menstrual matter of women, before it regularly begins to flow every month; वर्षद्वादशकादूर्ध्वं यदि पुष्पं बहिर्न हि । अन्तःपुष्पं भवत्येव पनसोदुम्बरादिवत् Kāśyapa; ˚ष्पम् is therefore the age between 12 and the menstruation period. -पूय a. ulcerous. -पेयम् Ved. drinking up. -प्रकृतिः f. 1 the internal nature or constitution of man. -2 the ministry or body of ministers of a king. -3 heart or soul. ˚प्रकोपः internal dissensions or disaffection; अणुरप्युपहन्ति विग्रहः प्रभुमन्तःप्रकृतिप्रकोपजः Ki.2.51. -प्रको- पनम् sowing internal dissensions, causing internal revolts; अन्तःप्रकोपनं कार्यमभियोक्तुः स्थिरात्मनः H.3.93. -प्रज्ञ a. knowing oneself, with an enlightened soul. -प्रतिष्ठानम् residence in the interior. -बाष्प a. 1 with suppressed tears; अन्तर्बाष्पश्चिरमनुचरो राजराजस्य दध्यौ Me.3. -2 with tears gushing up inside, bedimmed with tears; कोपात्˚ ष्पे स्मरयति मां लोचने तस्याः V.4.15. (-ष्पः) suppressed tears, inward tears; निगृह्य ˚ष्पम् Bh.3.6; Māl.5. -भावः, भावना see under अन्तर्भू separately. -भिन्न a. split or broken inside, perforated, bored (said of a pearl) Pt.4 (also torn by dissensions). -भूमिः f. interior of the earth. -भेदः discord, internal dissensions; ˚जर्जरं राजकुलम् Mk.4 torn by internal dissensions; अन्तर्भेदाकुलं गेहं न चिराद्विनशिष्यति 'a house divided against itself cannot stand long.' -भौम a. subterranean, underground. -मदावस्थ a. having the rutting state concealed within; आसीदनाविष्कृतदानराजि- रन्तर्मदावस्थ इव द्विपेन्द्रः R.2.7. -मनस् a. 1 sad, disconsolate, dejected, distracted. -2 one who has concentrated and turned his mind inward, lost in abstract meditation. -मुख a. (-खी f.) 1 going into the mouth, pointing or turned inward; प्रचण्डपरिपिण्डितः स्तिमितवृत्तिरन्तर्मुखः Mv. 5.26. -2 having an inward entrance of opening (बाह्यवस्तुपरिहारेण परमात्मविषयकतया प्रवेशयुक्तं चित्तादि). -3 an epithet of the soul called प्राज्ञ, when it is enjoying the sweet bliss of sleep (आनन्दभुक् चेतोमुखः प्राज्ञः इति श्रुतेः). -4 Spiritual minded, looking inwardly into the soul; 'अन्तर्मुखाः सततमात्मविदो महान्तः' Viś. Guṇā.139. (-खम्) a sort of surgical scissors (having an opening inside), one of the 2 instruments mentioned by Suśruta in chapter 8 of Sūtrasthāna. -मातृका [अन्तःस्थाः ष़ट्चक्रस्थाः मातृकाः अकारादिवर्णाः] a name given in the Tantras for the letters of the alphabet assigned to the six lotuses (पद्म) of the body; ˚न्यासः a term used in Tantra literature for the mental assignment of the several letters of the alphabet to the different parts of the body. -मुद्र a. sealed inside; N. of a form of devotion. -मृत a. still-born. -यागः mental sacrifice or worship, a mode of worship referred to in the Tantras. -यामः 1 suppression of the breath and voice. -2 ˚पात्रम्, a sacrificial vessel (ग्रहरूपं सामापराख्यं यज्ञियपात्रम्); according to others, a Soma libation made during the suppression of breath and voice; सुहवा सूर्यायान्तर्याममनु- मन्त्रयेत् Ait. Br. -यामिन् m. 1 regulating the soul or internal feelings, soul; Providence, Supreme Spirit as guiding and regulating mankind. Brahman; (according to the Bṛi. Ār. Up. अन्तर्यामिन 'the internal check' is the Supreme Being and not the individual soul; who standing in the earth is other than the earth, whom the earth knows not, whose body the earth is, who internally restrains and governs the earth; the same is thy soul (and mine, the internal check अन्तर्यामिन्, &c. &c.); अन्तराविश्य भूतानि यो बिभर्त्यात्मकेतुभिः । अन्तर्या- मीश्वरः साक्षाद्भवेत् &c. -2 wind; ˚ब्राह्मणम् N. of a Brāhmaṇa included in the Bṛi. Ār. Up. -योगः deep meditation, abstraction -लम्ब a. acute-angular. (-बः) an acute-angled triangle (opp. बहिर्लम्ब) (the perpendicular from the vertex or लम्ब falling within अन्तर् the triangle). -लीन a. 1 latent, hidden, concealed inside; ˚नस्य दुःखाग्नेः U.3.9; ˚भुजङ्गमम् Pt.1. -2 inherent. -लोम a. (P.V.4.117) covered with hair on the inside; (-मम्) [अन्तर्गतमाज्छाद्यं लोम अच्] the hair to be covered. -वंशः = ˚पुरम् q. v. -वंशिकः, -वासिकः [अन्तर्वंशे वासे नियुक्तः ठक्] a superintendent of the women's apartment.; Pt.3, K.93. Ak.2.8.8. -वण (वन) a. situated in a forest; ˚णो देशः P.VI.2.179 Sk. (-णम्) ind. within a forest. P.VIII.4.5. -वत् a. being in the interior; having something in the interior. -वती (वत्नी) Ved. [अन्तरस्त्यस्यां गर्भः] a pregnant woman; अन्तर्वत्नी प्रजावती R.15.13. -वमिः [अन्तः स्थित एव उद्गारशब्दं कारयति, वम्-इन्] indigestion, flatulence; belching. -वर्तिन्, -वासिन् a. being or dwelling inside, included or comprised in -वसुः N. of a Soma sacrifice (for राज्यकाम and पशुकाम). -वस्त्रम्, -वासस् n. an undergarment; गृहीत्वा तत्र तस्यान्तर्वस्त्राण्याभरणानि च । चेलखण्डं तमेकं च दत्वान्तर्वाससः कृते ॥. Ks.4.52. -वा a. [अन्तः अन्तरङ्गभावं अन्तःकरणं वा वाति गच्छति स्निग्धत्वेन, वा-विच् Tv.] forming part of oneself such as children, cattle &c. ˚वत् a. (अस्त्यर्थे मतुप् मस्य वः) having progeny, cattle &c; अन्तर्वावत्क्षयं दधे Rv.1.4.7; abounding with precious things inside. -adv. inwardly. -वाणि a. [अन्तःस्थिता शास्त्रवाक्यात्मिका वाणी यस्य] skilled or versed in scriptures, very learned (शास्त्रविद्). -विगाहः, -हनम् entering within, penetration. -विद्वस् a. Ved. (विदुषी f.) knowing correctly or exactly (knowing the paths between heaven and earth) Rv.1.72.7. -वेगः inward uneasiness or anxiety, inward fever. -वेदि a. pertaining to the inside of the sacrificial ground. -adv. within this ground. (-दिः -दी f.) [अन्तर्गता वेदिर्यत्र देशे] the tract of land (the Doab) between the rivers Gaṅgā and Yamunā, regarded as a sacred region and the principal seat of Āryan Brāhmaṇas; cf. एते भगवत्यौ भूमिदेवानां मूलमायतनमन्तर्वेदिपूर्वेण कलिन्दकन्यामन्दाकिन्यौ संगच्छेते A.R.7; it is supposed to have extended from Prayāga to Haradvāra and is also known by the names of शशस्थली and ब्रह्मावर्त. -m. (pl.) inhabitants of this land. -वेश्मन् n. the inner apartments, interior of a house. -वेश्मिकः n. a chamberlain. -वैशिकः Officer in charge of the harem. समुद्रमुपकरणमन्तर्वैशिकहस्तादादाय परिचरेयुः Kau. A.1.21. -शरः internal arrow or disease. -शरीरम् internal and spiritual part of man; the interior of the body. -शल्य a. having in the interior an arrow, pin or any such extraneous matter; rankling inside. -शीला N. of a river rising from the Vindhya mountain. -श्लेषः, -श्लेषणम् Ved. internal support (scaffolding &c.) एतानि ह वै वेदानामन्तः- श्लेषणानि यदेता व्याहृतयः Ait. Br. -संज्ञ a. inwardly conscious (said of trees &c.); ˚ज्ञा भवन्त्येते सुखदुःखसमन्विताः Ms.1.49. -सत्त्व a. having inward strength &c. (˚त्त्वा) 1 a pregnant woman. -2 the marking nut. -सन्तापः internal pain, sorrow, regret. -सरल a. upright at heart, or having Sarala trees inside; K.51. -सलिल a. with water (flowing) underground; नदीमिवान्तःसलिलां सरस्वतीम् R.3.9. -सार a. having inward strength and vigour, full of strong inside; powerful, strong, heavy or ponderous; ˚रैर्मन्त्रिभिर्घार्यते राज्यं सुस्तम्भैरिव मन्दिरम् Pt.1. 126; साराणि इन्धनानि Dk.132; ˚रं घन तुलयितुं नानिलः शक्ष्यति त्वाम् Me.2. (-रः) internal treasure or store, inner store or contents; वमन्त्युच्चैरन्तःसारम् H.2.13 internal matter or essence (and pus). -सुख a. whose delight is in self, inwardly happy यो$न्तःसुखो$न्तरारामः Bg. 5.24 -सेनम् ind. into the midst of armies. -स्थ a. (also written अन्तःस्थ) being between or in the midst. (-स्थः, -स्था) a term applied to the semivowels, य्, र्, ल्, व् as standing between vowels and consonants and being formed by a slight contact of the vocal organs (ईषत्स्पृष्टं अन्तस्थानाम्); or they are so called because they stand between स्पर्श (क-म) letters and ऊष्मन् (श, ष, स, ह). -स्था 1 a deity of the vital organs. -2 N. of one of the Ṛigveda hymns. ˚मुद्गरः the malleus of the ear. -स्वेदः [अन्तः स्वेदो मदजलस्यन्दनं यस्य] an elephant (in rut). -हणनम् striking in the middle. -हननम् N. of a country बाहीक P.VIII.4.24 Sk. -हस्तम् ind. in the hand, within reach of the hand. -हस्तीन a. being in the hand or within reach of the hand. -हासः laughing inwardly (in the sleeves), a secret or suppressed laugh; सान्तर्हासं कथितम् Me.113 with a suppressed laugh, with a gentle smile. -हृदयम् the interior of the heart.
antara अन्तर a. [अन्तं राति ददाति, रा-क] 1 Being in the inside, interior, inward, internal (opp. बाह्य); योन्तरो यमयति Śat. Br.; ˚र आत्मा Tait. Up.; कश्चनान्तरो धर्मः S. D. अन्तरापणवीथ्यश्च नानापण्योपशोभिताः अनुगच्छन्तु Rām.7.64.3. -2 Near, proximate (आसन्न); कृष्वा युजश्चिदन्तरम् Rv.1. 1.9. -3 Related, intimate, dear, closely connected (आत्मीय) (opp. पर); तदेतत्प्रेयः पुत्रात् ...... प्रेयो$न्यस्मात्सर्व- स्मादन्तरतरं यदयमात्मा Śat. Br.; अयमत्यन्तरो मम Bharata. -4 Similar (also अन्तरतम) (of sounds and words); स्थाने$न्तरतमः P.I.1.5; हकारस्य घकारोन्तरतमः Śabdak.; सर्वस्य पदस्य स्थाने शब्दतो$र्थतश्चान्तरतमे द्वे शब्दस्वरूपे भवतः P. VIII.1.1. Com. -5 (a) Different from, other than (with abl.); यो$प्सु तिष्ठन्नद्भ्यो$न्तरः Bṛi. Ār. Up.; आत्मा स्वभावो$न्तरो$न्यो यस्य स आत्मान्तरः अन्यस्वभावः व्यवसायिनो$न्तरम् P.VI.2.166 Sk. ततो$न्तराणि सत्त्वानि स्वादते स महाबलः Rām.7. 62.5. (b) The other; उदधेरन्तरं पारम् Rām. -6 Exterior, outer, situated outside, or to be worn outside (अन्तरं बहिर्योगोपसंव्यानयोः P.I.1.36) (In this sense it is declined optionally like सर्व in nom. pl. and abl. and loc. sing.) अन्तरे-रा वा गृहाः बाह्या इत्यर्थः (चण्डालादिगृहाः); अन्तरे-रा वा शाटकाः परिधानीया इत्यर्थः Sk.; so अन्तरायां पुरि, अन्तरायै नगर्यै, नमो$न्तरस्मै अमेधसाम् Vop. -रम् 1 (a) The interior, inside; ततान्तरं सान्तरवारिशीकरैः Ki.4.29,5.5; जालान्तरगते भानौ Ms.8.132; विमानान्तरलम्बिनीनाम् R.13.33; Mk.8.5, Ku. 7.62; अपि वनान्तरं श्रयति V.4.24; लीयन्ते मुकुलान्तरेषु Ratn. 1.26, Ki.3.58; अन्तरात् from inside, from out of; प्राकारपरिखान्तरान्निर्ययुः Rām.; अन्तरे in, into; वन˚, कानन˚, प्रविश्यान्तरे &c. (b) Hence, the interior of any thing, contents; purport, tenor; अत्रान्तरं ब्रह्मविदो विदित्वा Śvet. Up. (c) A hole, an opening; तस्य बाणान्तरेभ्यस्तु बहु सुस्राव शोणितम्. -2 Soul, heart; mind; सततमसुतरं वर्णयन्त्यन्तरम् Ki.5.18 the inmost or secret nature (lit. middle space or region); लब्धप्रतिष्ठान्तरैः भृत्यैः Mu.3.13 having entered the heart; सदृशं पुरुषान्तरविदो महेन्द्रस्य V.3. -3 The Supreme Soul. -4 Interval, intermediate time or space, distance; रम्यान्तरः Ś.4.11; किंचिदन्तरमगमम् Dk.6; अल्प- कुचान्तरा V.4.49; क्रोशान्तरेण पथि स्थिताः H.4 at the distance of; बृहद् भुजान्तरम् R.3.54; अन्तरे oft. translated by between, betwixt; गीतान्तरेषु Ku.3.38 in the intervals of singing; मरणजीवितयोरन्तरे वर्ते betwixt life and death; अस्त्रयोगान्तरेषु Rām.; तन्मुहूर्तकं बाष्पसलिलान्तरेषु प्रेक्षे तावदार्यपुत्रम् U.3 in the intervals of weeping; बाष्पविश्रामो$प्यन्तरे कर्तव्य एव U.4 at intervals; स्मर्तव्योस्मि कथान्तरेषु भवता Mk.7.7 in the course of conversation; कालान्तरावर्तिशुभाशुभानि H.1 v. l. See कालान्तरम्; सरस्वतीदृषद्वत्योर्यदन्तरम् Ms.2.17,22; द्यावापृथिव्यो- रिदमन्तरं हि व्याप्तं त्वयैकेन Bg.11.2; न मृणालसूत्रं रचितं स्तनान्तरे Ś.6.18 between the breasts; Bg.5.27; अस्य खलु ते बाणपथवर्तिनः कृष्णसारस्यान्तरे तपस्विन उपस्थिताः Ś.1; तदन्तरे सा विरराज धेनुः R.2.2;12.29. (b) Intervention (व्यवधान) oft. in the sense of 'through'; मेघान्तरालक्ष्यमि- वेन्दुबिम्बम् R.13.38 through the clouds; वस्त्रं अन्तरं व्यवधायकं यस्य स वस्त्रान्तरः P.VI.2.166 Sk.; महानद्यन्तरं यत्र तद्देशान्त- रमुच्यते; जालान्तरप्रेषितदृष्टिः R.7.9 peeping through a window; विटपान्तरेण अवलोकयामि Ś.1; क्षणमपि विलम्बमन्तरीकर्तु- मक्षमा K.36 to allow to come between or intervene; कियच्चिरं वा मैघान्तरेण पूर्णिमाचन्द्रस्य दर्शनम् U.3. -5 Room, place, space in general; मृणालसूत्रान्तरमप्यलभ्यम् Ku.1.4; न ह्यविद्धं तयोर्गात्रे बभूवाङ्गुलमन्तरम् Rām.; मूषिकैः कृते$न्तरे Y.1. 147; गुणाः कृतान्तराः K.4 finding or making room for themselves; न यस्य कस्यचिदन्तरं दातव्यम् K.266; देहि दर्शना- न्तरम् 84. room; पौरुषं श्रय शोकस्य नान्तरं दातुमर्हसि Rām. do not give way to sorrow; तस्यान्तरं मार्गते Mk.7.2 waits till it finds room; अन्तरं अन्तरम् Mk.2 make way, make way. -6 Access, entrance, admission, footing; लेभेन्तरं चेतसि नोपदेशः R.6.66 found no admission into (was not impressed on) the mind; 17.75; लब्धान्तरा सावरणे$पि गेहे 16.7. -7 Period (of time), term; मासान्तरे देयम् Ak.; सप्तैते मनवः । स्वे स्वेन्तरे सर्वमिदमुत्पाद्यापुश्चराचरम् Ms.1.63, see मन्वन्तरम्; इति तौ विरहान्तरक्षमौ R.8.56 the term or period of separation; क्षणान्तरे -रात् within the period of a moment. -8 Opportunity, occasion, time; देवी चित्रलेखामव- लोकयन्ती तिष्ठति । तस्मिन्नन्तरे भर्तोपस्थितः M.1. अत्रान्तरे प्रणम्याग्रे समुपविष्टः; Pt.1 on that occasion, at that time; अस्मिन्नन्तरे Dk.164; केन पुनरुपायेन मरणनिर्वाणस्यान्तरं संभावयिष्ये Māl.6; कृतकृत्यता लब्धान्तरा भेत्स्यति Mu.2.22 getting an opportunity; 9; यावत्त्वामिन्द्रगुरवे निवेदयितुं अन्तरान्वेषी भवामि Ś.7. find a fit or opportune time; शक्तेनापि सता जनेन विदुषा कालान्तरप्रेक्षिणा वस्तव्यम् Pt.3.12; waiting for a suitable opportunity or time; सारणस्यान्तरं दृष्ट्वा शुको रावणमब्रवीत् Rām. -9 Difference (between two things), (with gen. or in comp.) शरीरस्य गुणानां च दूरमत्यन्तमन्तरम् H.1.46; उभयोः पश्यतान्तरम् H.1.64, नारीपुरुषतोयानामन्तरं महदन्तरम् 2.39; तव मम च समुद्रपल्वलयोरिवान्तरम् M.1; Bg.13.34; यदन्तरं सर्षपशैलराजयोर्यदन्तरं वायसवैनतेययोः Rām.; द्रुमसानुमतां किमन्तरम् R.8.9;18.15; rarely with instr.; त्वया समुद्रेण च महदन्तरम् H.2; स्वामिनि गुणान्तरज्ञे Pt.1.11; difference; सैव विशिनष्टि पुनः प्रधानपुरषान्तरं सूक्ष्मम् Sāṅ. K. -1 (Math.) Difference, remainder also subtraction, cf. योगोन्तरेणोनयुतो$र्धितस्तौ राशी स्मृतौ संक्रमणाख्यमेतत् ॥ Līlā. -11 (a) Different, another, other, changed, altered (manner, kind, way &c.); (Note:- that in this sense अन्तर always forms the latter part of a compound and its gender remains unaffected i. e. neuter, whatever be the gender of the noun forming the first part; कन्यान्तरम् (अन्या कन्या), राजान्तरम् (अन्यो राजा), गृहान्तरम् (अन्यद् गृहम्); in most cases it may be rendered by the English word 'another'.); इदमवस्थान्तरमारोपिता Ś.3 changed condition; K.154; Mu.5; शुभाशुभफलं सद्यो नृपाद्देवाद्भवान्तरे Pt.1.121; जननान्तरसौहृदानि &Sacute.5.2 friendships of another (former) existence; नैवं वारान्तरं विधास्यते H.3 I shall not do so again; आमोदान् हरिदन्तराणि नेतुम् Bv.1.15, so दिगन्तराणि; पक्षान्तरे in the other case; देश˚, राज˚, क्रिया˚ &c. (b) Various, different, manifold (used in pl.); लोको नियम्यत इवात्मदशान्तरेषु Ś.4.2; मन्निमित्तान्यवस्थान्तराण्यवर्णयत् Dk.118 various or different states; 16; sometimes used pleonastically with अन्यत् &c.; अन्यत्स्थानान्तरं गत्वा Pt.1. -12 Distance (in space); व्यामो बाह्वोः सकरयोस्ततयोस्ति- र्यगन्तरम् Ak.; प्रयातस्य कथंचिद् दूरमन्तरम् Ks.5.8. -13 Absence; तासामन्तरमासाद्य राक्षरीनां वराङ्गना Rām.; तस्यान्तरं च विदित्वा ibid. -14 Intermediate member, remove, step, gradation (of a generation &c.); एकान्तरम् Ms.1.13; द्वयेकान्तरासु जातानाम् 7; एकान्तरमामन्त्रितम् P.VIII.1.55; तत्स्रष्टुरेकान्तरम् Ś.7.27 separated by one remove, See एकान्तर also. -15 Peculiarity, peculiar or characteristic possession or property; a (peculiar) sort, variety, or kind; व्रीह्यन्तरेप्यणुः Trik.; मीनो राश्यन्तरे, वेणुर्नृपान्तरे ibid.; प्रासङ्गो युगान्तरम् cf. also प्रधानपुरुषान्तरं सूक्ष्मम् Sāṅ. K.37. &c. -16 Weakness, weak or vulnerable point; a failing, defect, or defective point; प्रहरेदन्तरे रिपुम्, Śabdak. सुजयः खलु तादृगन्तरे Ki.2.52; असहद्भिर्माममिमित्रैर्नित्यमन्तरदर्शिभिः Rām; परस्यान्तरदर्शिना ibid.; कीटकेनेवान्तरं मार्गयमाणेन प्राप्तं मया महदन्तरम् Mk.9; अथास्य द्वादशे वर्षे ददर्श कलिरन्तरम् Nala.7.2.; हनूमतो वेत्ति न राक्षसो$न्तरं न मारुतिस्तस्य च राक्षसो$न्तरम् Rām. -17 Surety, guarantee, security; तेन तव विरूपकरणे सुकृतमन्तरे धृतम् Pt.4 he has pledged his honour that he will not harm you; आत्मान- मन्तरे$र्पितवान् K.247; अन्तरे च तयोर्यः स्यात् Y.2.239; भुवः संज्ञान्तरयोः P.III.2.179; धनिकाधमर्णयोरन्तरे यस्तिष्ठति विश्वासार्थं स प्रतिभूः Sk. -18 Regard, reference, account; न चैतदिष्टं माता मे यदवोचन्मदन्तरम् Rām. with reference to me; त्वदन्तरेण ऋणमेतत्. -19 Excellence, as in गुणान्तरं व्रजति शिल्पमाधातुः M.1.6 (this meaning may be deduced from 11). -2 A garment (परिधान). -21 Purpose, object, (तादर्थ्य) तौ वृषाविव नर्दन्तौ बलिनौ वासितान्तरे Mb.1.12.41; (Malli. on R.16.82). -22 Concealment, hiding; पर्व- तान्तरितो रविः (this sense properly belongs to अन्तर्-इ q. v.). -23 Representative, substitution. क्षात्रमाचरतो मार्गमपि बन्धोस्त्वदन्तरे Mb.12.1.3. -24 Destitution, being without (विना) which belongs to अन्तरेण. (अन्तरमवकाशाव- धिपरिधानान्तर्धिभेदतादर्थ्ये । छिद्रात्मीर्यावेनाबहिरवसरमध्येन्तरात्मनि च Ak.) [cf. L. alter] -25 Space (अवकाश); प्रेक्षतामृषि- सङ्घानां बभूव न तदान्तरम् Rām.7.14.19. -26 Separation (वियोग); भार्यापत्योरन्तरम् Mb.5.35.43. -27 A move or skilful play in wrestling; अन्योन्यस्थान्तरप्रेप्सू प्रचक्राते$न्तरं प्रति Mb.9.57.11. -28 A moulding of the pedestal and the base; षडंशं चान्तरे कर्णे उत्तरांशं तदूर्ध्वके । Māna.13.121; cf. स्थानात्मीयान्यतादर्थ्यरन्ध्रान्तर्धिषु चान्तरम् । परिधाने$वधौ मध्ये$- न्तरात्मनि नपुंसके । Nm. -Comp. -अपत्या a pregnant woman. -चक्रम् a technical term in augury Bṛi. S. chap.86. -ज्ञ a. knowing the interior, prudent, wise, foreseeing; नान्तरज्ञाः श्रियो जातु प्रियैरासां न भूयते Ki.11.24 not knowing the difference. -तत् a. spreading havoc. -द a. cutting the interior or heart. -दिशा, अन्तरा दिक् intermediate region or quarter of the compass. -दृश् a. realizing the Supreme Soul (परमात्मानुसंधायिन्). -पु(पू)रुषः the internal man, soul (the deity that resides in man and witnesses all his deeds); तांस्तु देवाः प्रपश्यन्ति स्वस्यैवान्तरपूरुषः; Ms.8.85. -पूजा = अन्तर-पूजा. -प्रभवः [अन्तराभ्यां भिन्नवर्णमातापितृभ्यां प्रभवति] one of a mixed origin or caste. (अम्बष्ठ, क्षत्तृ, करण, इ.); अन्तरप्रभवाणां च धर्मान्नो वक्तुमर्हसि Ms.1.2. -प्रश्नः an inner question, one contained in and arising out of what has been previously mentioned. -शायिन् -स्थ, -स्थायिन् -स्थित a. 1 inward, internal, inherent; ˚स्थैर्गुणैः शुभ्रैर्लक्ष्यते नैव केन चित् Pt. 1.221. -2 interposed, intervening, separate. -3 seated in the heart, an epithet of जीव.
annāvṛdh अन्नावृध् [अन्नं वर्धते अनेन वृध्-करणे क्विप्, पूर्वपददीर्घः] Increasing food; त्वा पितृभृतो जनित्रीः अन्नावृधं प्रति चरन्ति अन्नैः Rv.1.1.4.
anya अन्य a. [अन् अध्न्यादि˚ य; अन्यः, न्यस्मै, ˚स्मात्; n. अन्यत् &c.] 1 Another, different, other (भिन्न); another, other (generally); स एव त्वन्यः क्षणेन भवतीति विचित्रमेतत् Bh. 2.4; अन्यदेव भागधेयमेते निर्वपन्ति Ś.2; सर्वमन्यत् everything else; किमुतान्यहिंस्राः R.2.62; changed, altered; संप्रत्यन्ये वयम् Bh.3.66 quite different persons; oft. in comp. अन्यसङ्गात्, अनन्यसाधारण &c. -2 Other than, different from, else than (with abl. or as last member of comp.); नास्ति जीवितादन्यदभिमततरमिह सर्वजन्तूनाम् K.35; को$स्ति धन्यो मदन्यः Bv.4.37; उत्थितं ददृशे$न्यञ्च कबन्धेभ्यो न किंचन R.12.49; किमन्यदस्याः परिषदः श्रुतिप्रसादनतः Ś.1; oft. used in addition to ऋते or विना; ऋते समुद्रादन्यः को विभर्ति वडवानलम् Pt.5.35; किं नु खलु मे प्रियादर्श- नादृते शरणमन्यत् Ś.3. -3 Another person, one different from self (opp. स्व, आत्मीय); वासश्च धृतमन्यैर्न धारयेत् Ms.4.66. -4 Strange, unusual, extraordinary; अन्य एव स प्रकारः K.168; अन्या जगद्धितमयी मनसः प्रवृत्तिः Bv. 1.69; धन्या मृदन्यैव सा S. D. -5 Ordinary, any one; निरातङ्कः कन्यामन्यो$पि याचते Mv.1.31; cf. इतर. -6 Additional, new, more; अन्यान् दशसुवर्णान्प्रयच्छ Mk.2 another ten (coins); अन्यदन्यन्नलिनदलशयनम् K.157 new and new (changing every now and then); अन्यस्मिन् दिवसे another day; one of a number (with gen.); अन्यच्च moreover, besides, and again (used to connect sentences together); एक- अन्य the one-the other; एकः सख्यास्तव सह मया वामपादाभिलाषी । काङ्क्षन्त्यन्यो वदनमदिरां दौहृदच्छद्मनास्याः Me.8; see under एक also; अन्य-अन्य one another; अन्यः करोति अन्यो भुङ्क्ते one does, another suffers; अन्यन्मुखे अन्यन्निर्वहणे Mu.5; अन्यदुग्तं जातमन्यत् Ms.9.4,99; 8.24; कर्णे लगति चान्यस्य प्राणैरन्यो वियुज्यते Pt.1.35; अन्यदुच्छृङ्खलं सत्त्वमन्यच्छास्त्र- नियन्त्रितं Śi.2.62; अन्य-अन्य-अन्य &c. one, another, third, fourth &c., जल्पन्ति सार्धमन्येन पश्यन्त्यन्यं सविभ्रमाः । हृद्गतं चिन्त- यन्त्यन्यं प्रियः को नाम योषिताम् Pt.1.135; मनस्यन्यद्ववचस्यन्यत् कार्यमन्यद् दुरात्मनाम् H.1.97.; (in pl.) केचित्-अन्ये some- others; एके-अन्ये-तथान्ये (बीजमेके प्रशंसन्ति क्षेत्रमन्ये मनीषिणः । बीजक्षेत्रे तथैवान्ये तत्रेयं तु व्यवस्थितिः ॥) Ms.1.7;4.9;12.123. [cf. L. alius; Gr. allos for aljos, Zend anya]. -Comp. -अर्थ a. having a different meaning, sense, or purpose. -असाधारण a. not common to others, peculiar. -आश्र- यण a. going or passing over to another. -उदर्य a. born from another; नहि ग्रभायारणः सुशेवो$न्योदर्यो मनसा मन्तवा उ Rv. 7.4.8. (-र्यः) a step-mother's son, a half brother. (-र्या a half sister. -ऊढा a. married to another; another's wife. -कारुका a worm bred in excrement (शकृत्कीटः). -क्षेत्रम् 1 another field. -2 another or foreign territory. अन्यक्षेत्रे कृतं पापं पुण्यक्षेत्रे विनश्यति । पुण्यक्षेत्रे कृतं पापं वज्रलेपो भविष्यति ॥ -3 another's wife. -ग, -गामिन् a. 1 going to another. -2 adulterous, unchaste; वणिजां तु कुलस्त्रीव स्थिरा लक्ष्मीरन- न्यगा Ks.21.56;19.27. -गोत्र a. of a different family or lineage. -चित्त a. having the mind fixed on something or some one else; see ˚मनस्. -ज, -जात a. of a different origin. -जन्मन् a. another life or existence, regeneration, metempsychosis. -दुर्वह a. difficult to be borne by others. -देवत, -त्य, -दैवत्य a. addressed or referring to another deity (as a Vedic Mantra). -धर्मन् a. having another or different property. (-र्मः) different property or characteristic. -धी a. whose mind is turned away from God. -नाभि a. belonging to another family. -पदार्थः 1 another substance. -2 the sense of another word; ˚प्रधानो बहुव्रीहिः the Bahuvrīhi compound essentially depends on the sense of another word. -पर a. 1 devoted to another or something else. -2 expressing or referring to something else. -पुष्टा, -भृता 'reared by another', epithet of the cuckoo, which is supposed to be reared by the crow (called अन्यभृत्); अप्यन्यपुष्टा प्रतिकूलशब्दा Ku.1.45; कलमन्यभृतासु भाषितम् R.8.59. -पूर्वा [अन्यः पतिः पूर्वो यस्याः] 1 a womon already promised or betrothed to another. -2 a remarried widow (पुनर्भू) see अनन्यपूर्व. -बीज, -बीजसमुद्भव, -समुत्पन्न an adopted son (born from other parents), one who may be adopted as a son for want of legitimate issue. -भृत् m. a crow (rearing another, it being supposed to sit on the eggs of the cuckoo and to rear its young ones), cf. Ś5.22. -मनस्, -मनस्क, -मानस a. 1 having the mind fixed on something else; inattentive. -2 fickle, versatile, unsteady; अन्यमनसः स्त्रियः H.1.111 absentminded; possessed by a demon. -मातृजः a half-brother (born of another mother) असंसृष्ट्यापि बा$$दद्यात्संसृष्टो नान्यमातृजः Y.2.139. -रङ्गः the second court or theatre or a compound; Māna. 21.144. -राजन्, -राष्ट्रीय a. subject to another king or kingdom (Ved.). -रूप a. having another form, changed, altered; पद्मिनीं वान्यरूपाम् Me.85. (-पम्) another or changed form; ˚पेण in another form. -लिङ्ग, -ङ्गक a. following the gender of another word (i. e. the substantive), an adjective; ऊषवानूषरो द्वावप्यन्यलिङ्गौ Ak. -वादिन् a. 1 giving false evidence. -2 a defendant in general. -वापः the cuckoo leaving the eggs in the nests of other birds. -विवर्धित a. = पुष्ट a cuckoo. -व्रत a. following other (than Vedic) observances, devoted to other gods, infidel. -शाखः, -खकः a Bārhmaṇa who has gone over to another school (of religion &c.); an apostate. -संक्रान्त a. fixed on or transferred to another (woman); ˚हृदयः आर्यपुत्रः M.3,4. -संगमः intercourse with another; illicit intercourse. -साधारण a. common to many others. -स्त्री another's wife, a woman not one's own. [In Rhetoric she is considered as one of three chief female characters in a poetical composition, the other two being स्वीया and साधारणी स्त्री. अन्या may be either a damsel or another's wife. The 'damsel' is one not yet married, who is bashful and arrived at the age of puberty. As "another's wife" she is fond of festivals and similar occasions of amusement, who is a disgrace to her family and utterly destitute of modesty, see S. D. 18-11]. ˚गः an adulterer. यस्य स्तेनः पुरे नास्ति नान्यस्त्रीगो न दुष्टवाक्... स राजा शक्रलोकभाक्; Ms.8.386. [Note: Some compounds under अन्य will be found under अनन्य.]
anyataḥ अन्यतः adv. 1 From another; न चान्यतस्तस्य शरीररक्षा R.2.4; तीर्थोदकं च वह्निश्च नान्यतः शुद्धिमर्हतः U.1.13. -2 On one side; अन्यतः-अन्यतः, एकतः-अन्यतः on the one side, on the other side; तपनमण्डल- दीपितमेकतः सततनैशतमोवृतमन्यतः Ki.5.2; एकवस्तु सकलानि निमित्तान्यन्यतो हि मनसः प्रतिपत्तिः Nīti. -3 To another place, towards some other person or direction; गन्तव्यं वा ततो$न्यतः Ms.2.2; अन्यतो$पि नयने प्रेरयन्त्या Ś.2.2; आर्ये व्रजामो$न्यतः R.6.82. -4 From another ground or motive. -5 On the other side; on the contrary. -6 Otherwise; in another place, elsewhere. -Comp. -अरण्यम् Ved. a land which is woody here and there. Vāj.3.19. -एत, -एतस्, -एनी Ved. variegated or spotted on one side. -घातिन् a. striking in one direction. -वात a. suffering occasional wind (rheumatism). (-तः) a sort of eye-disease.
anyatra अन्यत्र adv. [अन्य-त्रल्] (oft. = अन्यस्मिन् with a subst. or adj. force) 1 Elsewhere, in another place (with abl.); अपत्याधिकारादन्यत्र लौकिकमपत्यमात्रं गोत्रम् P.IV.2.39 Com.; sometimes with विना; विना मलयमन्यत्र चन्दनं न प्ररोहति Pt.1.41; (with verbs of motion) to another place. -2 On another occasion, at another time than; oft. (in comp.); मधुपर्के च यज्ञे च पितुर्दैवतकर्मणि । अत्रैव पशवो हिंस्यान्नान्यत्रेत्यब्रवीन्मनुः Ms.5.41. -3 Except, without, other than; यथा फलानां जातानां नान्यत्र पतनाद्भयम् । एवं नरस्य जातस्य नान्यत्र मरणाद्भयम् ॥ Rām.2.15.17; Mv.6.8; R. 14.32; Bg.3.9; Y.1.215; अन्यत्र नैमिषेयसत्रात् V.5, Ms.4.164; oft. with the force of the nom. case; देवा अन्यत्रैवाश्विभ्यां सत्त्रं निषेदुः Kaus. Br. (अन्यत्र = अन्ये). -4 Otherwise, in another way, in the other case, in the other sense; सुराज्ञि देशे राजन्वान् स्यात्ततो$न्यत्र राजवान् Ak.; राजन्वती भूः, राजवान् अन्यत्र; चर्मण्वती नदी चर्मवती अन्यत्र P.VIII. 2.12,14 Sk. -Comp. -मनस्, -चित्त a. whose mind is directed to somthing else, inattentive. Śat. Br.14.
anyadā अन्यदा ind. 1 At another time, on another occasion, in any other case; अन्यदा भूषणं पुंसां क्षमा लज्जेव योषिताम् Śi.2.44, R.11.73. -2 Once, one day, at one time, once upon a time. अन्यदा भृशमुद्विग्नमना नष्टद्रविण इव कृपणः कश्मलं महदभिरम्भित इति होवाच Bhāg.5.8.15. -3 Sometimes, now and then.
anvartha अन्वर्थ a. [अनुगतः अर्थम्] Having the meaning clear or intelligible, having a meaning easily deducible from the etymology of the word; hence, true to the sense, significant; तथैव सो$भूदन्वर्थो राजा प्रकृतिरञ्जनात् R.4.12; अन्वर्था तैर्वसुन्धरा Ki.11.64; अन्वर्थसंज्ञैव परं त्रिमार्गगा Śi.12.23; अन्वर्थ एवायमधुना प्रलापो वर्तते U.3.; अन्वर्थतो$पि ननु राक्षस राक्षसो$सि Mu.5.7 in the true sense of the word, properly so called. -Comp. -ग्रहणम् literal acceptation of the meaning of a word (opp. to रूढ or conventional). -संज्ञा 1 an appropriate name, a technical term which directly conveys its own meaning; e. g. भविष्यन्ती a name for 'future' is an अन्वर्थसंज्ञा compared with लृट्. -2 a proper name the meaning of which is obvious.
anvita अन्वित p. p. 1 Followed or attended by, in company with, joined by; अमात्यपुत्रैः सवयोभिरन्वितः R.3.28. -2 Possessed of, having, possessing, endowed with; full of, seized or struck with, overpowered by; with instr. or in compound; कुलान्वितं कुकुलजा निन्दन्ति Pt. 1.415; धैर्य˚; गुण˚, वित्त˚; विस्मय˚ struck with wonder; भय˚, क्रोध˚, लोभ˚ &c. &c. -3 Connected with, linked to, following (as a consequence). -4 Connected grammatically; वर्णाः पदं प्रयोगार्हानन्वितैकार्थबोधकाः S. D.9. -5 Understood, reached by the mind. -6 Suitable, befitting; तपसा चान्वितो वेषस्त्वं राममहिषी ध्रुवम् Rām.5.33. 13. -Comp. -अर्थ a. having a meaning which is easily understood from the context. ˚वादः-अभिधानवादः a doctrine of the Mīmāṁsakas that words in a sentence convey meanings not independently or generally, but as connected with one another in that particular sentence; see अभिहितान्वयवादिन् under अभिधा and K. P.2.
apakṛṣ अपकृष् 1 P., 6 U. 1 (a) To draw back or away, draw off or aside, drag down, drag away, take or carry off, take or draw out, extract; आनायिभिस्ता- मपकृष्टनक्राम् R.16.55 drawn out; दन्ताग्रभिन्नमपकृष्य निरीक्षते च Rs.4.13 pulling off or back. (b) To take or carry away, remove; धैर्यं शोको$पकर्षति Rām.; किं त्वनुष्ठाननित्यत्वं स्वातन्त्र्यमपकर्षति U.1.8, Mv.4.33 prevents or interferes with freedom of action; क्षात्रं तेजो$पकर्षति Mv.1.32 destroys, robs one of. -2 To diminish, decrease, omit; अपकर्षेदेवं यावत्पञ्चदश Suśr. -3 To bend (as a bow); धनुःश्रेष्ठमपकृष्य Mb. -4 To lower or debase, dishonour, detract from, lessen the value of, disparage; पीडयन् भृत्यवर्गं हि आत्मानमपकर्षति Mb. -5. To bring or draw backwards; anticipate (as a word in a sentence) what occurs later on; अग्रिमसूत्रस्थं सर्वत्रग्रहणमिहापकृष्यते P. IV.1.17 Com. -Caus To remove, take away, lessen, diminish, detract from; काव्यस्यात्मभूतं रसमपकर्षयन्तः काव्य- स्यापकर्षकाः (दोषाः) उच्यन्ते S. D.1.
apaṭī अपटी [अल्पः पटः पटी, न. त.] 1 A screen or wall of cloth, particularly the screen or kanāt surrounding a tent. -2 A curtain. -Comp. -क्षेपः (अपटक्षेपः) tossing aside the curtain; ˚क्षेपेण (= अकस्मात्) 'with a (hurried) toss of the curtain', frequently occurring as a stage direction and denoting precipitate entrance on the stage which arises from fear, hurry, agitation &c., as when a character tossing up the curtain suddenly enters without the usual introduction ततः प्रविशति &c.
apaṇya अपण्य a. Not saleable (the Smrtod;itis name several things which ought not to be sold by particular persons and on particular occasions); जीविकार्थे चापण्ये P.V.3.99.
apatānakaḥ अपतानकः [अपक्रम्य अन्तरान्तरा तनुते तन् कर्तरि ण्वुल्] Spasmodic contraction with occasional convulsive fits; सो$पतानकसंज्ञो यः पातयत्यन्तरान्तरा Suśr.
apada अपद a. 1 Footless. -2 Having no office or post. -दः A reptile. -दम् No place or abode. -2 A wrong or bad place or abode; wrong timer चिरमपदे शङ्कितो$स्मि M.1 my doubts were out of place, ill-founded; प्रेम पश्यति भयान्यपदे$पि Ki.9.7 unreasonably. -3 A word which is not a pada or an inflected word. -4 Ether. -Comp. -अन्तर a. adjoining, cont iguous, very near. धर्मराजमिदं वाक्यमपदान्तरमब्रवीत् Mb.7.17.38. (-रम्) proximity, contiguity. -रुहा, -रोहिणी N. of a parasitical plant; (Mar. बादांगुळ, बांडगूळ).
apara अपर a. (treated as a pronoun in some senses) 1 Having nothing higher or superior, unrivalled. matchless; without rival or second (नास्ति परो यस्मात्); स्त्रीरत्नसृष्टिर- परा प्रतिभाति सा मे Ś.2.1; cf. अनुत्तम, अनुत्तर. -2 [न पृणाति संतोषयति पृ अच्] (a) Another, other (used as adj. or subst.). वासांसि जीर्णानि यथा विहाय नवानि गृह्णाति नरो$पराणि Bg.2.22. (b) More, additional; कृतदारो$परान् दारान् Ms.11.5. (c) Second, another Pt.4.37; स्वं केशवो$पर इवाक्रमितुं प्रवृत्तः Mk.5.2 like another (rival) Keśava. (d) Different; other; अन्ये कृतयुगे धर्मास्त्रेतायां द्वापरे$परे Ms. 1.85; Ks.26.235; Pt.4.6 (with gen.). (e) Ordinary, of the middle sort (मध्यम); परितप्तो$प्यपरः सुसंवृतिः Śi. 16.23. -3 Belonging to another, not one's own (opp. स्व); यदि स्वाश्चापराश्चैव विन्देरन् योषितो द्विजाः Ms.9.85 of another caste. -4 Hinder, posterior, latter, later, (in time space) (opp. पूर्व); the last; पूर्वां सन्ध्यां जपंस्तिष्ठेत्स्वकाले चापरां चिरम् Ms.4.93; रात्रेरपरः कालः Nir.; oft. used as first member of a genitive Tatpuruṣa comp. meaning 'the hind part,' 'latter part or half'; ˚पक्षः the latter half of a month; ˚हेमन्तः latter half of a winter; ˚कायः hind part of the body &c.; ˚वर्षा, ˚शरद् latter part of the rains, autumn &c. -5 Following, the next. -6 Western; पयसि प्रतित्सुरपराम्बुनिधेः Śi.9.1. पूर्वापरौ तोयनिधी वगाह्य Ku. 1.1; Mu.4.21 -7 Inferior, lower (निकृष्टः); अपरेयमि- तस्त्वन्यां प्रकृतिं विद्धि मे पराम् Bg.7.5. -8 (In Nyāya) Non-extensive, not covering too much, one of the two kinds of सामान्य, see Bhāṣā P.8. (परं = अधिकवृत्ति higher अपरम् = न्यूनवृत्ति lower or अधिकदेशवृत्तित्वं परं, अल्पदेशवृत्तित्वं अपरम् Muktā.) -9 Distant; opposite. When अपर is used in the singular as a correlative to एक the one, former, it means the other, the latter; एको ययौ चैत्ररथप्रदेशान् सौराज्य- रम्यानपरो विदर्भान् R.5.6; when used in pl. it means 'others', 'and others', and the words generally used as its correlatives are एके, केचित्-काश्चित् &c., अपरे, अन्ये; केचिद् रक्तपटीकृताश्च जटिलाः कापालिकाश्चापरे Pt.4.34; एके समूहुर्बलरेणुसंहतिं शिरोभिराज्ञामपरे महीभृतः Śi.12.45 some-others; शाखिनः केचिदध्यष्ठुर्न्यमाङ्क्षुरपरे$म्बुधौ । अन्ये त्वलङ्घिषुः शैलान् गुहास्त्वन्ये न्यलेषत ॥ केचिदासिषत स्तब्धा भयात्केचिदघूर्णिषुः । उदतारिषुरम्भोधिं वानराः सेतुनापरे Bk. 15.31.33. -रः 1 the hind foot of an elephant; बद्धापराणि परितो निगडान्यलावीत् Śi.5.48 (Malli. चरमपादाग्राणि). -2 An enemy (न पृणाति सन्तोषयति). -रा 1 Western direction, the west अपरां च दिशं प्राप्तो वालिना समभिद्रुतः Rām.4.46.18. -2 The hind part of an elephant. -3 Sacred learning, learning the four Vedas with the 6 Aṅgas. -4 The womb; the outer skin of the embryo. -5 Suppressed menstruation in pregnancy. -री Ved. The future, future times; उतापरीभ्यो मघवा विजिग्ये Rv.1.32.13. -रम् 1 The future, any thing to be done in future (कार्य); तदेतद्ब्रह्मापूर्वमपरमनन्तम् Bṛi. Ār. Up. (नास्ति अपरं कार्यं यस्य). -2 The hind quarter of an elephant. -रम् adv. Again, moreover, in future, for the future; अपरं च moreover; अपरेण behind, west of, to the west of (with gen. or acc.). [cf. Goth. afar; Germ. aber, as in aberglauben]. -Comp. -अग्नि (अग्नी dual) 1 the southern and western fires (दक्षिण and गार्हपत्य). -2 the last fire i. e. used at the funeral ceremony (˚ग्निः). -अङ्गम् one of the 8 divisions of गुणीभूतव्यङ्ग्य (the second kind of काव्य) mentioned in K. P.5. In this the व्यङ्ग्य or suggested sense is subordinate to something else; अगूढमपरस्याङ्गम्; अपरस्य रसादेर्वाच्यस्य वा (वाक्यार्थीभूतस्य) अङ्गं रसादि अनुरणनरूपं वा; e. g. अयं स रसनोत्कर्षी पीनस्तनविमर्दनः । नाभ्यूरुजघनस्पर्शी नीवीविस्रंसनः करः ॥ where शृङ्गार is subordinate to करुण. -अन्त a. living at the western borders. (-न्तः) 1 the western border or extremity, the extreme end or term. the western shore. -2 (pl.) the country or inhabitants of the western borders near the Sahya mountain; अपरान्तजयोद्यतैः (अनीकैः) R.4.53 Western people. दशार्णाश्चापरान्ताश्च द्विपानां मध्यमा मताः Kau.A.1.2. -3 the kings of this country. -4 death, Pātañjala Yogadarśana 3.22. ˚ज्ञानम् anticipation of one's end. -5 the hind foot of an elephant; मृदुचलदपरान्तोदीरितान्दूनिनादम् Śi.11.7;18.32. -6 Islander, inhabitant of an island (द्वीपवासिन्) कोट्यापरान्ताः सामुद्रा रत्नान्युपहरन्तु ते Rām.2.82.8. -अन्तकः 1. = ˚अन्तः pl. -2 N. of a song; अपरान्तकमुल्लोप्यं मद्रकं प्रकरीं तथा । औवेणकं सरोबिन्दुमुत्तरं गीतकानि च ॥ Y3.113; ˚अन्तिका N. of a metre consisting of 64 mātrās. -अपराः, -रे, -राणि another and another, several, various. -अपरम् ind. Further and further (उत्तरोत्तरम्); अहं हि वचनं त्वत्तः शुश्रूषुरपरापरम् Mb.5.136.14. -अर्धम् the latter or second half. -अह्न [fr.अहन् changed to अह्न P.II. 4.29, V.4.88.] the latter part of the day, the afternoon, closing or last watch of the day; Ms.3.278; अपराह्णशीतलतरेण शनैरनिलेन Śi.9.4; ˚तन, ˚ह्णेतन belonging to this time; ˚कृतं P.II.1.45. -इतरा the east. -कान्य- कुब्ज a. situated in or belonging to the western part of Kānyakubja. -कालः later period. -गात्रम् a minor limb (hand, foot etc.); कोपप्रसादापरगात्रहस्तः (सुप्तः क्षितौ) रावणगन्धहस्ती) Rām.6.19.1. -गोदानम् (also गोडनि or गोडानि) N. of a country to the west of Mahāmeru (according to Buddhistic ideas). -ज a. born later or at the end of the world. (-जः) the destroying fire. -जनः an inhaditant of the west, the western people. -दक्षिणम् ind. in the south-west (belonging to the तिष्ठद्गु class). -पक्षः 1 the second or dark half of the month. -2 the other or opposite side; a defendant (in law). -पञ्चालाः the western Pañchālas. -पर a. one and the other, several, various; अपरपराः सार्थाः गच्छन्ति P.VI.1.144. Sk. several caravans go; (अपरे च परे च सकृदेव गच्छन्ति). -पाणिनीयाः the pupils of Pāṇini living in the west. -प्रणेय a. easily led or influenced by others, docile, tractable. -भावः 1 being another or different, difference. -2 succession, continuation. -रात्रः [अपरं रात्रेः] the latter or closing part of night, the last watch of night (P.V.4.87); उत्थायापररात्रान्ते प्रयताः सुसमाहिताः Bhāg.8.4.24. ˚कृतम् P.II.1.45. -लोकः the other world, the next world. Paradise. -वक्त्रा, -क्त्रम् N. of a metre. -वैराग्यम् a kind of Vairāgya mentioned by Patañjali (दुष्टानुश्राविकविषयवितृष्णस्य वशीकारसंज्ञं वैराग्यम्). -सक्थम् the hind thigh. -स्वस्तिकम् the western point in the horizon. -हैमन a. belonging to the latter helf of winter (P.VII.3.11).
apalap अपलप् 1 P. 1 To deny, disown; राजदेयमपलपितम् Kull. on Ms.8.4; refuse; शतमपलपति P.I.3.44. Sk. -2 To conceal, hide. -3 To detract from, slander. -Caus. To outwit, overreach, deceive; अपलापयमानस्य शत्रूंस्तस्याभवन्मतिः Bk.8.44. अपलपनम् apalapanam अपलापः apalāpḥ अपलपनम् अपलापः 1 Concealing, hiding; कृततिग्मद्यु- तिमण़्डलापलापैः Śi.2.28. -2 Concealment or denial of knowledge, evasion; न हि प्रत्यक्षसिद्धस्यापलापः कर्तुं शक्यते Ś. B. -3 Detraction, concealment of truth, thoughts, feelings &c.; उन्मुखदर्शनापलपनैः पिण्डार्थमायस्यतः Mu.3.14. -4 Affection, regard. -5 (In medicine) The part between the shoulder and the ribs. -Comp. -दण्डः (in law) a fine laid on one who denies the charge on which he is convicted.
apavādaḥ अपवादः 1 Censuring, reviling; censure, reproach, blame, abuse; आः तातापवादभिन्नमर्याद U.5; लोकापवादो बल- वान्मतो मे R.14.4; लोकापवादाद्भयम् Bh.2.62; scandal, evil report; चिरकालान्मया श्रुतस्तवापवादः Pt.I; Ki.11.25, 14.12; Mk.9.3; U.1; Pt.4; Y.2.27; देव्यामपि हि वैदेह्यां सापवादो यतो जनः U.1.6 spreading or indulging in scandals about; न केवलमत्याहितं सापवादमपि U.2; साप- वादम् censuringly Māl.9. -2 An exception, a special rule that restricts or sets aside a general rule (opp. उत्सर्ग); मा हिंस्यात्सर्वभूतानि इति उत्सर्गः; वायव्यं श्वेतमालभेत इत्यपवादः; अपवादैरिवोत्सर्गाः कृतव्यावृत्तयः परैः Ku.2.27; R. 15.7; ˚प्रत्ययः exceptional suffix; ˚स्थलम् a case for a special rule. -3 An order, command; ततो$पवादेन पताकिनीपते- श्चचाल निर्ह्रादवती महाचमूः Ki.14.27. cf. ... अपवादस्तु निन्दने । आज्ञायां स्यात् ... । Nm. -4 Refutation; (in Vedānta Phil.) refutation as of a wrong imputation or belief; रज्जुविव- र्तस्य सर्पस्य रज्जुमात्रत्ववत्, वस्तुभूतब्रह्मणो विवर्तस्य प्रपञ्चादेः वस्तु- भूतरूपतो$पदेशः अपवादः Tv.; अध्यारोपापवादाभ्यां वस्तुतत्त्वविनिश्चयः Vedānta; hence also, a means of refutation. -5 Confidence, trust. -6 Love; familiarity. -7 A small bell or other instrument sounded to decoy deer; मधुकरैरपवाद- करैरिव Śi.6.9; (˚करैः = व्याधैः; अपवादं मृगवञ्चनाय घण्टादि- कुत्सितवाद्यं कुर्वन्ति तैः Malli.) अपवादक apavādaka अपवादिन् apavādin अपवादक अपवादिन् a. 1 Blaming, censuring, reviling, traducing, defaming; मृगयापवादिना माढव्येन Ś.2. -2 Opposing; contradicting, excepting, setting aside, excluding.
apavārita अपवारित p. p. Covered, concealed; ˚तं प्रवहणं तिष्ठति Mk.6 covered; vanished, disappeared; -तम्, -अपवारित- कम् Concealed or secret manner. -तम्, अपवारितकेन, अपवार्य ind. Frequently occurring in dramas in the sense of 'apart', 'aside to another' (opp. प्रकाशम्); it is speaking in such a way that only the person addressed may hear it; तद्भवेदपवारितम् । रहस्यं तु यदन्यस्य परावृत्त्य प्रकाश्यते । त्रिपताककरेणान्यमपवार्यान्तरा कथाम् S. D.6.
apavṛt अपवृत् 1 A. To turn back, turn away, depart; तस्मादपावर्तत दूरकृष्टा R.6.58; तस्मादपावर्तत कुण्डिनेशः 7.33. -Caus. 1 To turn back or away, turn aside, bend; व्यपोढपार्श्वैरपवर्तितत्रिकाः Ki.4.15; आसक्ततिर्यगपवर्तितदृष्टि वक्त्रम् (वहन्ती) Māl.1.4. -2 (Math.) To divide (as by a common measure) without remainder; समेन केनाप्यपवर्त्य- हारभाज्यौ भजेद्वा सति संभवे तु Līlā. -3 To reduce to a common measure.
apasṛ अपसृ 1 P. 1 To walk off, go or get away, depart; अपसर इतः begone, avaunt hence, get you gone; अपसरा- ग्रतः Pt.1. -2 To withdraw, retire, retreat, turn back; यदपसरति मेषः कारणं तत्प्रहर्तुम् Pt.3.43. -3 To vanish, disappear; यस्यानुष्ठानेन मे सन्ततिविनाशदुःखमपसरति Pt.1. -4 To escape, elude the sight. -Caus. To make (a thing or person) go away or retire, take or put away, remove, drive away or off, throw aside; अपसारय घनसारम् K. P.9; अपसार्यतां वेत्रलता Pt. 1 put aside, take away; Ms.7.149.
apasphiga अपस्फिग a. Having badly formed hips; (P.VI. 2.187). अपस्फुर् (-स्फूः), -र, -रत् a. Injured (Sāy.); swelling, increasing (?).
apahāniḥ अपहानिः f. 1 Leaving, abandonment; stopping. -2 Ceasing, vanishing. -3 Exception, exclusion.
apahnavaḥ अपह्नवः 1 Concealment, hiding; concealment of one's knowledge, feelings &c. स कदाचिदुपासीन आत्मापह्नवमात्मनः Bhāg.9.6.49. -2 Denial or disowning of the truth, dissimulation; ˚वे ज्ञः P.I.3.44; ज्ञातं मया ते हृदयं सखे मा$पह्नवं कृथाः Ks.1.92. -3 Appeasing, satisfying. -4 Love, affection.
apāka अपाक a. Ved, [fr अञ्च् with अप] 1 (a) Situated aside or behind. (b) Remote, distant. (c) Coming from a distant place. (d) Unequalled, incomparable, very great (अनल्प Sāy.); ˚चक्षुस् of unequalled brightness; ˚कात्-का aside, distant; ˚केस्थ standing behind. -2 Raw, unripe. -3 Not matured, undigested. -4 (पाकः पक्तव्यप्रज्ञः मूर्खः तद्विलक्षणः Of matured intellect, wise) Rv.1.11.2,6.12.2. -कः 1 Indigestion (of food &c.). -2 Immaturity not being ripe or cooked. -Comp. -ज a. 1 not produced by cooking or ripening. -2 natural, original; Bhāṣā P.42,95. -शाकम् ginger.
apāvṛtta अपावृत्त p. p. 1 (With abl.) Turned away from, averted, reversed, repelled, driven back, defeated; कथं द्रक्ष्याम्यपावृत्तां परैरिव हतां चमूम् Rām.2.12.64. -2 (Actively used) Dismissing, scorning, rejecting with contempt; प्रतिग्रहादपावृत्तः सन्तुष्टो येन केन चित् Mb. -त्तम् 1 Rolling on the ground (of a horse). -2 Moving aside (a war manouvre); परावृत्तमपावृत्तमपद्रुतमवप्लवम् Rām.6.4.25.
apās अपास् [अप्-अस्] 4 P. 1 (a) To throw or fling away, cast away or off, leave, keep or put aside, reject, discard (opinion also); सारं ततो ग्राह्यमपास्य फल्गु Pt.1.5; किमित्यपांस्याभरणानि यौवने धृतं त्वया वार्धकशोभि वल्कलम् Ku.5.44; निरस्तगाम्भीर्यमपास्तपुष्पकम् Śi.1.55; इत्यादीनामपि काव्यलक्षणत्वम- पास्तम् S. D. rejected, discarded. (b) To leave, abandon, desert, quit, retire or withdraw from; यदि समरमपास्य नास्ति मृत्योर्भयम् Ve.3.5. -2 To scare, disperse, drive away; अपास्य चास्य यन्तारम् Mb. -3 To leave behind, leave in a deserted condition; to disregard, take no notice of, condemn.
api अपि ind. (Sometimes with the अ dro